Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Bda02g00767	ATGAGCGTGATCGACATTCTATTCCGGGTCGACGCCATATGCAAGAGGTACGACAAGTACGATATTGAAAAACAGCGGGACCTCAATGCCTATGGCGATGACGCCTTTGCTAGACTCTACGCCGTCGTTGAAGCCGACATTGAATCAATTCTTCGGAAGTCGGCGATGGCTGCAGCTGATCAGAACAGGGCATCTGCGGCGGCGCTGAACGCAGAGATACGGTCGAAAAAGGCCCGATTGATGGATGAAGTTGTAAAGTTGAAGAAATTGAACCAGAAGAAGGTTAAGGGCCTGTCGAAAGAAGAACAGGCCATTCGTGAGGATTTGGTTCTTGCATTACCAGATAGAATCCAAGCAATCCGAGATGGAACGACCAATGCAGCCAAAATCTCTGGAGGATGGGCTTCTTCAACATCCCATAAAAATATCAAATTTGACTCCTCAGGTAAAGATCATTTTTTTTCTATGGATTCGGTTTTCTTAATCAATAGCTGTAGTCGATTAATTCGATCCGAAATAGGTGAATGTTTTGAGAGTGAATATTTCGAGCAATCCGAAGAAGCAAACCGGTTTAGGCAAGAGTATGAACTACGGAAAATGAAACAGGCATGTCTAGGCGTTATATCCGAAGGATTGGACACTTTGAAAAATCTGGCCCTTGATATGAACGAGGAAATGGATCGACAAGTTCCGTTGATTGATGAGATCGATACAAAGGTGGACAAAGTGACTTCTGATCTGAGAAATACGAATGTTAGGCTCAAGGAAAATCTCTTCAAGATGAGATCCAGCCGAAACTTCTGCATCGACATTATCCTGCTGTGTGTAATTCTGGGAATAGTTTCATACTTATACAAGTAA	861	43.32	MSVIDILFRVDAICKRYDKYDIEKQRDLNAYGDDAFARLYAVVEADIESILRKSAMAAADQNRASAAALNAEIRSKKARLMDEVVKLKKLNQKKVKGLSKEEQAIREDLVLALPDRIQAIRDGTTNAAKISGGWASSTSHKNIKFDSSGKDHFFSMDSVFLINSCSRLIRSEIGECFESEYFEQSEEANRFRQEYELRKMKQACLGVISEGLDTLKNLALDMNEEMDRQVPLIDEIDTKVDKVTSDLRNTNVRLKENLFKMRSSRNFCIDIILLCVILGIVSYLYK	286

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
2	48420942	48422360	-	Bda006205.1	Bda02g00767	3062

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Bda02g00767	286	PANTHER	SYNTAXIN-73	1	153	-	-
Bda02g00767	286	CDD	SNARE_Qc	205	256	-	-
Bda02g00767	286	Pfam	SNARE domain	232	282	IPR000727	-
Bda02g00767	286	PANTHER	SYNTAXIN-73	170	285	-	-
Bda02g00767	286	Coils	Coil	70	90	-	-
Bda02g00767	286	ProSiteProfiles	t-SNARE coiled-coil homology domain profile.	195	257	IPR000727	-
Bda02g00767	286	SUPERFAMILY	SNARE fusion complex	203	255	-	-
Bda02g00767	286	PANTHER	SYNTAXIN	170	285	IPR045242	-
Bda02g00767	286	PANTHER	SYNTAXIN	1	153	IPR045242	-
Bda02g00767	286	Gene3D	-	203	256	-	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Bda02g00767	K08506	SYP7; syntaxin of plants SYP7	-	vvi:100258712	348.206

Dupl-types

Select	Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
	Bda02g00767	Bda-Chr2:48420942	Bda08g00006	Bda-Chr8:91241	1.33E-39	dispersed

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi6g289	.	.	Bda02g00767	.	Bpe01g00179	.	.	.	.	.	.	.	.	.	.	Cpe05g00828	.	.	.	.	.	.	.	.	Cla02g02052	Cam02g2177	Cec02g2216	Cco02g2256	Clacu02g2162	Cmu02g2099	Cre02g2412	.	Cone5ag1222	.	.	.	.	.	Cme11g01789	.	Blo14g00167	.	.	.	.	.	Bma11g00164	Sed05g2859	Cmo02g00885	Cmo20g00513	Cma02g00885	.	.	Car20g00420	.	.	Bhi10g00561	Tan05g0265	Cmetu11g0284	.	Hepe08g0878	.	.	.	.	.	.	.	.	.	.	.	.	.

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Bda13g01286	.	440	803	SNARE and Associated Proteins	AT3G24350	59.5	1.5e-97	353.2
Bda01g00978	.	1	341	SNARE and Associated Proteins	AT3G24350	61.5	9.0e-95	344.0
Bda11g01860	.	1	294	SNARE and Associated Proteins	AT2G18260	55.0	5.7e-82	301.2
Bda14g01003	.	1	290	SNARE and Associated Proteins	AT2G18260	55.0	1.4e-80	296.6
Bda06g00929	.	1	293	SNARE and Associated Proteins	AT2G18260	51.8	1.6e-76	283.1
Bda05g01127	.	22	278	SNARE and Associated Proteins	AT3G11820	78.6	1.9e-109	392.5
Bda03g00658	.	19	279	SNARE and Associated Proteins	AT3G11820	74.3	2.6e-106	382.1
Bda01g00422	.	19	279	SNARE and Associated Proteins	AT3G11820	71.6	1.9e-101	365.9
Bda01g00430	.	19	279	SNARE and Associated Proteins	AT3G11820	71.6	1.9e-101	365.9
Bda09g01276	.	31	281	SNARE and Associated Proteins	AT3G11820	66.1	5.7e-93	337.8
Bda03g00659	.	19	238	SNARE and Associated Proteins	AT3G11820	57.1	5.3e-67	251.5
Bda02g00552	.	31	159	SNARE and Associated Proteins	AT3G11820	56.6	6.8e-38	154.8
Bda03g00658	.	1	279	SNARE and Associated Proteins	AT3G52400	62.5	5.4e-89	324.7
Bda01g00422	.	1	279	SNARE and Associated Proteins	AT3G52400	61.2	8.6e-87	317.4
Bda01g00430	.	1	279	SNARE and Associated Proteins	AT3G52400	61.2	8.6e-87	317.4
Bda05g01127	.	29	278	SNARE and Associated Proteins	AT3G52400	66.4	2.1e-85	312.8
Bda09g01276	.	1	281	SNARE and Associated Proteins	AT3G52400	56.0	2.0e-80	296.2
Bda09g01276	.	1	299	SNARE and Associated Proteins	AT4G03330	67.9	3.0e-107	385.2
Bda03g00658	.	1	279	SNARE and Associated Proteins	AT4G03330	56.1	1.3e-78	290.0
Bda05g01127	.	1	282	SNARE and Associated Proteins	AT4G03330	53.4	2.9e-78	288.9
Bda01g00422	.	1	284	SNARE and Associated Proteins	AT4G03330	52.4	3.6e-76	282.0
Bda01g00430	.	1	284	SNARE and Associated Proteins	AT4G03330	52.4	3.6e-76	282.0
Bda02g00552	.	1	159	SNARE and Associated Proteins	AT4G03330	63.6	3.7e-49	192.2
Bda03g00659	.	1	201	SNARE and Associated Proteins	AT4G03330	52.6	1.4e-48	190.3
Bda09g01276	.	1	303	SNARE and Associated Proteins	AT1G61290	77.2	1.5e-122	436.0
Bda03g00658	.	1	279	SNARE and Associated Proteins	AT1G61290	59.1	3.5e-84	308.5
Bda05g01127	.	1	277	SNARE and Associated Proteins	AT1G61290	58.6	2.3e-83	305.8
Bda01g00422	.	1	294	SNARE and Associated Proteins	AT1G61290	54.7	4.8e-81	298.1
Bda01g00430	.	1	294	SNARE and Associated Proteins	AT1G61290	54.7	4.8e-81	298.1
Bda02g00552	.	1	159	SNARE and Associated Proteins	AT1G61290	74.2	2.7e-60	229.2
Bda09g01276	.	1	303	SNARE and Associated Proteins	AT1G11250	75.6	4.3e-119	424.5
Bda03g00658	.	1	279	SNARE and Associated Proteins	AT1G11250	60.9	3.0e-88	322.0
Bda05g01127	.	1	278	SNARE and Associated Proteins	AT1G11250	59.4	1.2e-87	320.1
Bda01g00422	.	1	284	SNARE and Associated Proteins	AT1G11250	57.7	3.5e-84	308.5
Bda01g00430	.	1	284	SNARE and Associated Proteins	AT1G11250	57.7	3.5e-84	308.5
Bda02g00552	.	1	159	SNARE and Associated Proteins	AT1G11250	70.4	1.2e-55	213.8
Bda06g00358	.	1	307	SNARE and Associated Proteins	AT3G03800	63.2	3.4e-95	345.1
Bda06g00358	.	1	204	SNARE and Associated Proteins	AT5G08080	62.3	7.1e-58	220.7
Bda06g01261	BCT	1	263	SNARE and Associated Proteins	AT5G16830	63.2	5.9e-78	287.7
Bda06g01264	.	1	263	SNARE and Associated Proteins	AT5G16830	63.2	2.3e-77	285.8
Bda08g00639	BCT	1	263	SNARE and Associated Proteins	AT5G16830	62.5	9.5e-76	280.4
Bda08g00639	BCT	1	274	SNARE and Associated Proteins	AT5G46860	70.4	5.3e-84	307.8
Bda06g01264	.	1	263	SNARE and Associated Proteins	AT5G46860	70.0	5.9e-83	304.3
Bda06g01261	BCT	1	263	SNARE and Associated Proteins	AT5G46860	69.6	6.5e-82	300.8
Bda08g00639	BCT	1	257	SNARE and Associated Proteins	AT4G17730	66.5	1.1e-76	283.5
Bda06g01264	.	1	257	SNARE and Associated Proteins	AT4G17730	64.2	5.8e-75	277.7
Bda06g01261	BCT	1	257	SNARE and Associated Proteins	AT4G17730	64.2	2.2e-74	275.8
Bda01g01045	.	1	184	SNARE and Associated Proteins	AT4G17730	54.0	1.2e-43	173.7
Bda13g01915	.	1	176	SNARE and Associated Proteins	AT4G17730	53.1	4.2e-41	165.2
Bda08g00639	BCT	65	256	SNARE and Associated Proteins	AT1G32270	58.3	3.2e-49	192.6
Bda06g01261	BCT	65	256	SNARE and Associated Proteins	AT1G32270	58.3	4.2e-49	192.2
Bda06g01264	.	65	256	SNARE and Associated Proteins	AT1G32270	58.3	4.2e-49	192.2
Bda14g00262	.	1	337	SNARE and Associated Proteins	AT5G05760	65.5	2.0e-112	402.5
Bda13g01286	.	440	803	SNARE and Associated Proteins	AT3G24350	59.5	1.5e-97	353.2
Bda01g00978	.	1	341	SNARE and Associated Proteins	AT3G24350	61.5	9.0e-95	344.0
Bda01g01644	.	1	341	SNARE and Associated Proteins	AT5G26980	75.4	2.6e-125	445.3
Bda01g01638	.	1	341	SNARE and Associated Proteins	AT5G26980	75.4	2.6e-125	445.3
Bda08g01094	.	16	263	SNARE and Associated Proteins	AT5G26980	78.6	7.3e-96	347.4
Bda01g01644	.	1	339	SNARE and Associated Proteins	AT4G02195	63.9	2.6e-101	365.5
Bda01g01638	.	1	339	SNARE and Associated Proteins	AT4G02195	63.9	2.6e-101	365.5
Bda08g01094	.	16	261	SNARE and Associated Proteins	AT4G02195	67.6	6.4e-84	307.8
Bda01g01644	.	1	339	SNARE and Associated Proteins	AT3G05710	75.2	4.8e-127	451.1
Bda01g01638	.	1	339	SNARE and Associated Proteins	AT3G05710	75.2	4.8e-127	451.1
Bda08g01094	.	17	261	SNARE and Associated Proteins	AT3G05710	82.0	4.5e-101	364.8
Bda09g00411	BCT,CCT	1	232	SNARE and Associated Proteins	AT1G16240	72.4	6.2e-89	323.9
Bda05g00693	CCT	1	234	SNARE and Associated Proteins	AT1G16240	60.3	9.7e-74	273.5
Bda07g00381	BCT,CCT	1	195	SNARE and Associated Proteins	AT1G16240	70.8	5.9e-71	264.2
Bda09g00411	BCT,CCT	1	232	SNARE and Associated Proteins	AT1G79590	70.4	2.8e-85	312.0
Bda05g00693	CCT	1	233	SNARE and Associated Proteins	AT1G79590	61.4	1.9e-73	272.7
Bda07g00381	BCT,CCT	1	195	SNARE and Associated Proteins	AT1G79590	69.7	1.3e-71	266.5
Bda09g00403	.	63	264	SNARE and Associated Proteins	AT1G28490	67.3	7.6e-67	250.4
Bda07g00367	.	55	226	SNARE and Associated Proteins	AT1G28490	60.6	2.8e-53	205.3
Bda02g00767	.	1	286	SNARE and Associated Proteins	AT3G09740	56.4	1.6e-80	296.2
Bda02g00767	.	1	286	SNARE and Associated Proteins	AT3G45280	56.4	1.1e-78	290.0
Bda02g00767	.	1	286	SNARE and Associated Proteins	AT3G61450	52.3	9.8e-75	276.9
Bda14g00163	.	65	263	SNARE and Associated Proteins	AT1G51740	65.5	1.3e-65	246.5

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0002038	1	2	1	1	1	2	3	2	2	2	2	2	3	3	2	3	2	2	3	2	3	2	2	2	2	2	3	2	2	2	63

Transcriptome

Select	Gene	Chr	Type	da1	da2	da3	da4	da5	da6	da7	da8	da9	da10
	Bda02g00767	Bda_Chr02	FPKM	14.027232	14.819884	1.80503	1.743242	1.669301	1.646173	1.226392	6.637885	6.600932