Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bda09g01276 ATGAACGATCTGTTCTCTAACTCTTTCAAAAAATACGCCGACCTGAAGCAGCAGGCGTACGAAGACGGAATGGAGGCAGGAAACGAGACTGTAGATCTCGACAAATTCTTTGAAGACGTTGAGAATGTGAAGGAAGACATGAAACAGGTGGAAAAGCTCTACAAGAGACTGCAAGAAGCAAATGAAGAAAGCAAAGTAGTTCACAACGCCAAAACCATGAAAGAATTGAGAGCAAGAATGGATCAAGATGTCAGCCAGGTCTTAAGAAGAGTCAAAGTGATCAAAGGAAAGCTCGAAGCTCTCGATCGATCGAACGCATCTCATCGGAGCCTTCCCGGGTGCGGTCCCGGCTCGTCTGCCGATAGAACAAGAACCTCAGTGGTGAGTGGATTGGGGAAGAAACTTAAAGACACCATGGATGATTTTCAGAGCTTAAGAGCTAGAATGAATGCCGAATACAAGGAAACAGTAGAACGCAGGTATTTCACAATCACAGGAGAGAAGGCAAATGAAGAAACAATTGAGACTCTGATATCTAGCGGAGAAAGCGAAAATTTTCTGCAGAAAGCGATTCAAGAACAGGGTAGAGGCCAAATAATGGACACAATATCAGAAATACAAGAGAGGCACGATGCAGTGAAGGAGATAGAGAAGAACCTGATTGAGCTGCACCAGATATTTCTGGACATGGCTGCGCTTGTGGAGGCGCAGGGGCATCAGCTTAACGACATAGAGAGTCACGTTGCACATGCTAATTCGTTTGTCCGGCGAGGCACTCAGCAACTGCAGGAGGCCAAAGAACAGCAGAAAAGCTCGAGGAAATGGACGTGCATTGCTGTAATTCTCGGCGCCGTTCTCGTTGCCGTTCTGCTCTTCCCGCTTTTGACGTCGATTTTGCCCCACTTGATGTAG 912 46.6 MNDLFSNSFKKYADLKQQAYEDGMEAGNETVDLDKFFEDVENVKEDMKQVEKLYKRLQEANEESKVVHNAKTMKELRARMDQDVSQVLRRVKVIKGKLEALDRSNASHRSLPGCGPGSSADRTRTSVVSGLGKKLKDTMDDFQSLRARMNAEYKETVERRYFTITGEKANEETIETLISSGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTQQLQEAKEQQKSSRKWTCIAVILGAVLVAVLLFPLLTSILPHLM 303
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
9 44512231 44513142 - Bda032344.1 Bda09g01276 13526

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bda09g01276 303 CDD SNARE_syntaxin1-like 202 264 - -
Bda09g01276 303 Pfam Syntaxin 35 238 IPR006011 GO:0016020
Bda09g01276 303 PANTHER T-SNARE-RELATED 10 295 - -
Bda09g01276 303 CDD SynN 33 190 IPR006011 GO:0016020
Bda09g01276 303 Pfam SNARE domain 240 291 IPR000727 -
Bda09g01276 303 Coils Coil 33 67 - -
Bda09g01276 303 Gene3D - 33 160 - -
Bda09g01276 303 MobiDBLite consensus disorder prediction 106 127 - -
Bda09g01276 303 PANTHER SYNTAXIN 10 295 IPR045242 -
Bda09g01276 303 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 203 265 IPR000727 -
Bda09g01276 303 ProSitePatterns Syntaxin / epimorphin family signature. 209 248 IPR006012 GO:0005484|GO:0006886|GO:0016020
Bda09g01276 303 Gene3D - 192 295 - -
Bda09g01276 303 SUPERFAMILY t-snare proteins 31 258 IPR010989 GO:0016020|GO:0016192
Bda09g01276 303 SMART tSNARE_6 198 265 IPR000727 -
Bda09g01276 303 SMART SynN_4 28 154 IPR006011 GO:0016020
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bda09g01276 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101217140 520.776
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bda01g00422 Bda-Chr1:30755288 Bda09g01276 Bda-Chr9:44512231 7.28E-117 dispersed
Bda03g00658 Bda-Chr3:5593717 Bda09g01276 Bda-Chr9:44512231 1.38E-123 dispersed
Bda05g01127 Bda-Chr5:59493476 Bda09g01276 Bda-Chr9:44512231 7.02E-123 dispersed
Bda09g01276 Bda-Chr9:44512231 Bda11g01860 Bda-Chr11:53717274 1.17E-65 dispersed
Bda14g01003 Bda-Chr14:8450716 Bda09g01276 Bda-Chr9:44512231 8.26E-64 dispersed
Bda06g00358 Bda-Chr6:5725017 Bda09g01276 Bda-Chr9:44512231 1.61E-87 transposed
Bda02g00552 Bda-Chr2:46377171 Bda09g01276 Bda-Chr9:44512231 6.98E-95 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bda13g01286 . 440 803 SNARE and Associated Proteins AT3G24350 59.5 1.5e-97 353.2
Bda01g00978 . 1 341 SNARE and Associated Proteins AT3G24350 61.5 9.0e-95 344.0
Bda11g01860 . 1 294 SNARE and Associated Proteins AT2G18260 55.0 5.7e-82 301.2
Bda14g01003 . 1 290 SNARE and Associated Proteins AT2G18260 55.0 1.4e-80 296.6
Bda06g00929 . 1 293 SNARE and Associated Proteins AT2G18260 51.8 1.6e-76 283.1
Bda05g01127 . 22 278 SNARE and Associated Proteins AT3G11820 78.6 1.9e-109 392.5
Bda03g00658 . 19 279 SNARE and Associated Proteins AT3G11820 74.3 2.6e-106 382.1
Bda01g00422 . 19 279 SNARE and Associated Proteins AT3G11820 71.6 1.9e-101 365.9
Bda01g00430 . 19 279 SNARE and Associated Proteins AT3G11820 71.6 1.9e-101 365.9
Bda09g01276 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 5.7e-93 337.8
Bda03g00659 . 19 238 SNARE and Associated Proteins AT3G11820 57.1 5.3e-67 251.5
Bda02g00552 . 31 159 SNARE and Associated Proteins AT3G11820 56.6 6.8e-38 154.8
Bda03g00658 . 1 279 SNARE and Associated Proteins AT3G52400 62.5 5.4e-89 324.7
Bda01g00422 . 1 279 SNARE and Associated Proteins AT3G52400 61.2 8.6e-87 317.4
Bda01g00430 . 1 279 SNARE and Associated Proteins AT3G52400 61.2 8.6e-87 317.4
Bda05g01127 . 29 278 SNARE and Associated Proteins AT3G52400 66.4 2.1e-85 312.8
Bda09g01276 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 2.0e-80 296.2
Bda09g01276 . 1 299 SNARE and Associated Proteins AT4G03330 67.9 3.0e-107 385.2
Bda03g00658 . 1 279 SNARE and Associated Proteins AT4G03330 56.1 1.3e-78 290.0
Bda05g01127 . 1 282 SNARE and Associated Proteins AT4G03330 53.4 2.9e-78 288.9
Bda01g00422 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 3.6e-76 282.0
Bda01g00430 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 3.6e-76 282.0
Bda02g00552 . 1 159 SNARE and Associated Proteins AT4G03330 63.6 3.7e-49 192.2
Bda03g00659 . 1 201 SNARE and Associated Proteins AT4G03330 52.6 1.4e-48 190.3
Bda09g01276 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 1.5e-122 436.0
Bda03g00658 . 1 279 SNARE and Associated Proteins AT1G61290 59.1 3.5e-84 308.5
Bda05g01127 . 1 277 SNARE and Associated Proteins AT1G61290 58.6 2.3e-83 305.8
Bda01g00422 . 1 294 SNARE and Associated Proteins AT1G61290 54.7 4.8e-81 298.1
Bda01g00430 . 1 294 SNARE and Associated Proteins AT1G61290 54.7 4.8e-81 298.1
Bda02g00552 . 1 159 SNARE and Associated Proteins AT1G61290 74.2 2.7e-60 229.2
Bda09g01276 . 1 303 SNARE and Associated Proteins AT1G11250 75.6 4.3e-119 424.5
Bda03g00658 . 1 279 SNARE and Associated Proteins AT1G11250 60.9 3.0e-88 322.0
Bda05g01127 . 1 278 SNARE and Associated Proteins AT1G11250 59.4 1.2e-87 320.1
Bda01g00422 . 1 284 SNARE and Associated Proteins AT1G11250 57.7 3.5e-84 308.5
Bda01g00430 . 1 284 SNARE and Associated Proteins AT1G11250 57.7 3.5e-84 308.5
Bda02g00552 . 1 159 SNARE and Associated Proteins AT1G11250 70.4 1.2e-55 213.8
Bda06g00358 . 1 307 SNARE and Associated Proteins AT3G03800 63.2 3.4e-95 345.1
Bda06g00358 . 1 204 SNARE and Associated Proteins AT5G08080 62.3 7.1e-58 220.7
Bda06g01261 BCT 1 263 SNARE and Associated Proteins AT5G16830 63.2 5.9e-78 287.7
Bda06g01264 . 1 263 SNARE and Associated Proteins AT5G16830 63.2 2.3e-77 285.8
Bda08g00639 BCT 1 263 SNARE and Associated Proteins AT5G16830 62.5 9.5e-76 280.4
Bda08g00639 BCT 1 274 SNARE and Associated Proteins AT5G46860 70.4 5.3e-84 307.8
Bda06g01264 . 1 263 SNARE and Associated Proteins AT5G46860 70.0 5.9e-83 304.3
Bda06g01261 BCT 1 263 SNARE and Associated Proteins AT5G46860 69.6 6.5e-82 300.8
Bda08g00639 BCT 1 257 SNARE and Associated Proteins AT4G17730 66.5 1.1e-76 283.5
Bda06g01264 . 1 257 SNARE and Associated Proteins AT4G17730 64.2 5.8e-75 277.7
Bda06g01261 BCT 1 257 SNARE and Associated Proteins AT4G17730 64.2 2.2e-74 275.8
Bda01g01045 . 1 184 SNARE and Associated Proteins AT4G17730 54.0 1.2e-43 173.7
Bda13g01915 . 1 176 SNARE and Associated Proteins AT4G17730 53.1 4.2e-41 165.2
Bda08g00639 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 3.2e-49 192.6
Bda06g01261 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 4.2e-49 192.2
Bda06g01264 . 65 256 SNARE and Associated Proteins AT1G32270 58.3 4.2e-49 192.2
Bda14g00262 . 1 337 SNARE and Associated Proteins AT5G05760 65.5 2.0e-112 402.5
Bda13g01286 . 440 803 SNARE and Associated Proteins AT3G24350 59.5 1.5e-97 353.2
Bda01g00978 . 1 341 SNARE and Associated Proteins AT3G24350 61.5 9.0e-95 344.0
Bda01g01644 . 1 341 SNARE and Associated Proteins AT5G26980 75.4 2.6e-125 445.3
Bda01g01638 . 1 341 SNARE and Associated Proteins AT5G26980 75.4 2.6e-125 445.3
Bda08g01094 . 16 263 SNARE and Associated Proteins AT5G26980 78.6 7.3e-96 347.4
Bda01g01644 . 1 339 SNARE and Associated Proteins AT4G02195 63.9 2.6e-101 365.5
Bda01g01638 . 1 339 SNARE and Associated Proteins AT4G02195 63.9 2.6e-101 365.5
Bda08g01094 . 16 261 SNARE and Associated Proteins AT4G02195 67.6 6.4e-84 307.8
Bda01g01644 . 1 339 SNARE and Associated Proteins AT3G05710 75.2 4.8e-127 451.1
Bda01g01638 . 1 339 SNARE and Associated Proteins AT3G05710 75.2 4.8e-127 451.1
Bda08g01094 . 17 261 SNARE and Associated Proteins AT3G05710 82.0 4.5e-101 364.8
Bda09g00411 BCT,CCT 1 232 SNARE and Associated Proteins AT1G16240 72.4 6.2e-89 323.9
Bda05g00693 CCT 1 234 SNARE and Associated Proteins AT1G16240 60.3 9.7e-74 273.5
Bda07g00381 BCT,CCT 1 195 SNARE and Associated Proteins AT1G16240 70.8 5.9e-71 264.2
Bda09g00411 BCT,CCT 1 232 SNARE and Associated Proteins AT1G79590 70.4 2.8e-85 312.0
Bda05g00693 CCT 1 233 SNARE and Associated Proteins AT1G79590 61.4 1.9e-73 272.7
Bda07g00381 BCT,CCT 1 195 SNARE and Associated Proteins AT1G79590 69.7 1.3e-71 266.5
Bda09g00403 . 63 264 SNARE and Associated Proteins AT1G28490 67.3 7.6e-67 250.4
Bda07g00367 . 55 226 SNARE and Associated Proteins AT1G28490 60.6 2.8e-53 205.3
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G09740 56.4 1.6e-80 296.2
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G45280 56.4 1.1e-78 290.0
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G61450 52.3 9.8e-75 276.9
Bda14g00163 . 65 263 SNARE and Associated Proteins AT1G51740 65.5 1.3e-65 246.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0005716 1 1 1 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 37