Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bda11g01860 ATGAATGATCTGATGACGAAATCGTTCTTAAGTTACGTGGAATTGAAGAAACAGTCGATGAAAGACATGGAAGCCGATTACGACGTTGGAATGGGCCAACTCAATCCTTCTTACGAACGAAATCTCTCCAAGTTCTTCGAAGAAGTTGGCCAAATCAAAACCGAAATGGAAGAGATCTCCAATCTCTTGGACGAACTCAAAACACTCAATGAGGAGGCAAAATCGATTTTCAGCGCCAAGATTCTTCGCGGGCTTAGAGATCGAATGGATTGGAACATGGTTTTGATCCTTCGCAAAGCAAAGGTCGTAAAATCGAGGCTAGAATTGCTCGATCAATCCAATGCGAAAAATAGAAGAAATTCAACAGCCTTTAAGGAATGCAGTCCTGTTGATAGAACCAAGGTTTCCATCACAAATGGGATAAGAGTCAGGCTGAGAGAATTGATGAATGATTTTCAGTTTTTGAGAGAGAGAATTCTGGATGATCACAAGGAAGATCTAAGGAGGACGTACTATACAGCAACCGGTGAGCAACTAAGTGAGGAAATGATCGAGAAGATAGCCATGGGAGGCGAGAGAATTGAACTATTGCAGGATAAAAAAGACAACAGAGAGAGCAATGACGCCATTTTAGACATTCAGAGAAGCTTGAACAACCTTCATCAAGTATTTCTTGACATGGCTGTGCTGGTTGAGAATCAAGGAGAAAAAATGGATGACATCGAGGAGAACGTGGCTAGTGCAGGAACCTTCATCCATGGCGGAACGAATAGTCTTTACTACGCTAATCAGACGAAGAAGGGGAGCAAGAAATGGGCTTACTGGGTTGCGGCTGTCGGACTGATCATAATCCTGGTTTGCTTTATTGCAACCTTAGTTTCTTGA 885 42.49 MNDLMTKSFLSYVELKKQSMKDMEADYDVGMGQLNPSYERNLSKFFEEVGQIKTEMEEISNLLDELKTLNEEAKSIFSAKILRGLRDRMDWNMVLILRKAKVVKSRLELLDQSNAKNRRNSTAFKECSPVDRTKVSITNGIRVRLRELMNDFQFLRERILDDHKEDLRRTYYTATGEQLSEEMIEKIAMGGERIELLQDKKDNRESNDAILDIQRSLNNLHQVFLDMAVLVENQGEKMDDIEENVASAGTFIHGGTNSLYYANQTKKGSKKWAYWVAAVGLIIILVCFIATLVS 294
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
11 53717274 53718158 + Bda008798.1 Bda11g01860 16968

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bda11g01860 294 Coils Coil 49 79 - -
Bda11g01860 294 CDD SynN 42 194 IPR006011 GO:0016020
Bda11g01860 294 PANTHER SYNTAXIN-112 3 290 - -
Bda11g01860 294 SUPERFAMILY t-snare proteins 41 255 IPR010989 GO:0016020|GO:0016192
Bda11g01860 294 PANTHER SYNTAXIN 3 290 IPR045242 -
Bda11g01860 294 CDD SNARE_syntaxin1-like 204 259 - -
Bda11g01860 294 Gene3D - 38 167 - -
Bda11g01860 294 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 200 262 IPR000727 -
Bda11g01860 294 Gene3D - 195 293 - -
Bda11g01860 294 SMART SynN_4 37 164 IPR006011 GO:0016020
Bda11g01860 294 Pfam Syntaxin 44 235 IPR006011 GO:0016020
Bda11g01860 294 SMART tSNARE_6 195 262 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bda11g01860 K08486 STX1B_2_3; syntaxin 1B/2/3 - jre:108997509 391.734
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bda06g00929 Bda-Chr6:25095255 Bda11g01860 Bda-Chr11:53717274 8.95E-117 dispersed
Bda09g01276 Bda-Chr9:44512231 Bda11g01860 Bda-Chr11:53717274 1.17E-65 dispersed
Bda11g01860 Bda-Chr11:53717274 Bda02g00552 Bda-Chr2:46377171 3.89E-27 dispersed
Bda08g00943 Bda-Chr8:17704860 Bda11g01860 Bda-Chr11:53717274 6.53E-08 transposed
Bda11g01860 Bda-Chr11:53717274 Bda14g01003 Bda-Chr14:8450716 8.94E-168 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g990 Blo04g00912 Blo16g00051 . . Bpe15g00424 . . . . . Cma03g00740 . Car03g00676 . Sed14g1127 . Cpe10g00620 Bhi03g01315 Tan03g1990 Cmetu08g1065 . Hepe04g1076 . . . . . . . . . . . . . . . . . . . Bda11g01860 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Csa06g03248 Chy02g00640 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bda13g01286 . 440 803 SNARE and Associated Proteins AT3G24350 59.5 1.5e-97 353.2
Bda01g00978 . 1 341 SNARE and Associated Proteins AT3G24350 61.5 9.0e-95 344.0
Bda11g01860 . 1 294 SNARE and Associated Proteins AT2G18260 55.0 5.7e-82 301.2
Bda14g01003 . 1 290 SNARE and Associated Proteins AT2G18260 55.0 1.4e-80 296.6
Bda06g00929 . 1 293 SNARE and Associated Proteins AT2G18260 51.8 1.6e-76 283.1
Bda05g01127 . 22 278 SNARE and Associated Proteins AT3G11820 78.6 1.9e-109 392.5
Bda03g00658 . 19 279 SNARE and Associated Proteins AT3G11820 74.3 2.6e-106 382.1
Bda01g00422 . 19 279 SNARE and Associated Proteins AT3G11820 71.6 1.9e-101 365.9
Bda01g00430 . 19 279 SNARE and Associated Proteins AT3G11820 71.6 1.9e-101 365.9
Bda09g01276 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 5.7e-93 337.8
Bda03g00659 . 19 238 SNARE and Associated Proteins AT3G11820 57.1 5.3e-67 251.5
Bda02g00552 . 31 159 SNARE and Associated Proteins AT3G11820 56.6 6.8e-38 154.8
Bda03g00658 . 1 279 SNARE and Associated Proteins AT3G52400 62.5 5.4e-89 324.7
Bda01g00422 . 1 279 SNARE and Associated Proteins AT3G52400 61.2 8.6e-87 317.4
Bda01g00430 . 1 279 SNARE and Associated Proteins AT3G52400 61.2 8.6e-87 317.4
Bda05g01127 . 29 278 SNARE and Associated Proteins AT3G52400 66.4 2.1e-85 312.8
Bda09g01276 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 2.0e-80 296.2
Bda09g01276 . 1 299 SNARE and Associated Proteins AT4G03330 67.9 3.0e-107 385.2
Bda03g00658 . 1 279 SNARE and Associated Proteins AT4G03330 56.1 1.3e-78 290.0
Bda05g01127 . 1 282 SNARE and Associated Proteins AT4G03330 53.4 2.9e-78 288.9
Bda01g00422 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 3.6e-76 282.0
Bda01g00430 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 3.6e-76 282.0
Bda02g00552 . 1 159 SNARE and Associated Proteins AT4G03330 63.6 3.7e-49 192.2
Bda03g00659 . 1 201 SNARE and Associated Proteins AT4G03330 52.6 1.4e-48 190.3
Bda09g01276 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 1.5e-122 436.0
Bda03g00658 . 1 279 SNARE and Associated Proteins AT1G61290 59.1 3.5e-84 308.5
Bda05g01127 . 1 277 SNARE and Associated Proteins AT1G61290 58.6 2.3e-83 305.8
Bda01g00422 . 1 294 SNARE and Associated Proteins AT1G61290 54.7 4.8e-81 298.1
Bda01g00430 . 1 294 SNARE and Associated Proteins AT1G61290 54.7 4.8e-81 298.1
Bda02g00552 . 1 159 SNARE and Associated Proteins AT1G61290 74.2 2.7e-60 229.2
Bda09g01276 . 1 303 SNARE and Associated Proteins AT1G11250 75.6 4.3e-119 424.5
Bda03g00658 . 1 279 SNARE and Associated Proteins AT1G11250 60.9 3.0e-88 322.0
Bda05g01127 . 1 278 SNARE and Associated Proteins AT1G11250 59.4 1.2e-87 320.1
Bda01g00422 . 1 284 SNARE and Associated Proteins AT1G11250 57.7 3.5e-84 308.5
Bda01g00430 . 1 284 SNARE and Associated Proteins AT1G11250 57.7 3.5e-84 308.5
Bda02g00552 . 1 159 SNARE and Associated Proteins AT1G11250 70.4 1.2e-55 213.8
Bda06g00358 . 1 307 SNARE and Associated Proteins AT3G03800 63.2 3.4e-95 345.1
Bda06g00358 . 1 204 SNARE and Associated Proteins AT5G08080 62.3 7.1e-58 220.7
Bda06g01261 BCT 1 263 SNARE and Associated Proteins AT5G16830 63.2 5.9e-78 287.7
Bda06g01264 . 1 263 SNARE and Associated Proteins AT5G16830 63.2 2.3e-77 285.8
Bda08g00639 BCT 1 263 SNARE and Associated Proteins AT5G16830 62.5 9.5e-76 280.4
Bda08g00639 BCT 1 274 SNARE and Associated Proteins AT5G46860 70.4 5.3e-84 307.8
Bda06g01264 . 1 263 SNARE and Associated Proteins AT5G46860 70.0 5.9e-83 304.3
Bda06g01261 BCT 1 263 SNARE and Associated Proteins AT5G46860 69.6 6.5e-82 300.8
Bda08g00639 BCT 1 257 SNARE and Associated Proteins AT4G17730 66.5 1.1e-76 283.5
Bda06g01264 . 1 257 SNARE and Associated Proteins AT4G17730 64.2 5.8e-75 277.7
Bda06g01261 BCT 1 257 SNARE and Associated Proteins AT4G17730 64.2 2.2e-74 275.8
Bda01g01045 . 1 184 SNARE and Associated Proteins AT4G17730 54.0 1.2e-43 173.7
Bda13g01915 . 1 176 SNARE and Associated Proteins AT4G17730 53.1 4.2e-41 165.2
Bda08g00639 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 3.2e-49 192.6
Bda06g01261 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 4.2e-49 192.2
Bda06g01264 . 65 256 SNARE and Associated Proteins AT1G32270 58.3 4.2e-49 192.2
Bda14g00262 . 1 337 SNARE and Associated Proteins AT5G05760 65.5 2.0e-112 402.5
Bda13g01286 . 440 803 SNARE and Associated Proteins AT3G24350 59.5 1.5e-97 353.2
Bda01g00978 . 1 341 SNARE and Associated Proteins AT3G24350 61.5 9.0e-95 344.0
Bda01g01644 . 1 341 SNARE and Associated Proteins AT5G26980 75.4 2.6e-125 445.3
Bda01g01638 . 1 341 SNARE and Associated Proteins AT5G26980 75.4 2.6e-125 445.3
Bda08g01094 . 16 263 SNARE and Associated Proteins AT5G26980 78.6 7.3e-96 347.4
Bda01g01644 . 1 339 SNARE and Associated Proteins AT4G02195 63.9 2.6e-101 365.5
Bda01g01638 . 1 339 SNARE and Associated Proteins AT4G02195 63.9 2.6e-101 365.5
Bda08g01094 . 16 261 SNARE and Associated Proteins AT4G02195 67.6 6.4e-84 307.8
Bda01g01644 . 1 339 SNARE and Associated Proteins AT3G05710 75.2 4.8e-127 451.1
Bda01g01638 . 1 339 SNARE and Associated Proteins AT3G05710 75.2 4.8e-127 451.1
Bda08g01094 . 17 261 SNARE and Associated Proteins AT3G05710 82.0 4.5e-101 364.8
Bda09g00411 BCT,CCT 1 232 SNARE and Associated Proteins AT1G16240 72.4 6.2e-89 323.9
Bda05g00693 CCT 1 234 SNARE and Associated Proteins AT1G16240 60.3 9.7e-74 273.5
Bda07g00381 BCT,CCT 1 195 SNARE and Associated Proteins AT1G16240 70.8 5.9e-71 264.2
Bda09g00411 BCT,CCT 1 232 SNARE and Associated Proteins AT1G79590 70.4 2.8e-85 312.0
Bda05g00693 CCT 1 233 SNARE and Associated Proteins AT1G79590 61.4 1.9e-73 272.7
Bda07g00381 BCT,CCT 1 195 SNARE and Associated Proteins AT1G79590 69.7 1.3e-71 266.5
Bda09g00403 . 63 264 SNARE and Associated Proteins AT1G28490 67.3 7.6e-67 250.4
Bda07g00367 . 55 226 SNARE and Associated Proteins AT1G28490 60.6 2.8e-53 205.3
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G09740 56.4 1.6e-80 296.2
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G45280 56.4 1.1e-78 290.0
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G61450 52.3 9.8e-75 276.9
Bda14g00163 . 65 263 SNARE and Associated Proteins AT1G51740 65.5 1.3e-65 246.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002433 5 3 5 4 2 1 2 1 2 2 1 1 2 1 2 1 1 3 2 1 2 3 2 2 1 1 1 2 1 4 61
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bda11g01860 Bda_Chr11 FPKM 2.593819 2.839987 2.032301 2.720301 3.446567 4.808718 4.447667 1.801794 2.335891