Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bda14g00345 ATGGCTTCCAACACGTTAATGAGCTGCGGAATCGCGGCAGTGGCGTACCCGTCTGTCCTCTCGTCGTCCAAATCGAAGTTCGCCGCTTCTTTCGCACTTCCTTCGGGATATGCCAATGCGTCGTCACGCTTCTCCATGTCCGCAGAATGGATGCCCGGCCAGCCAAGACCTCCATACCTGGATGGTTCTGCTCCGGGAGATTTTGGGTTTGACCCACTTGGGTTGGGTTCAGTGCCCGAGAATCTGGAGAGGTTCAAAGAGTCTGAACTCATCCATTGCCGATGGGCCATGCTTGCTGTTCCTGGGGTCTTGATTCCAGAGGCGTTGGGGTTAGGCAACTGGGTGAAGGCTCAAGAGTGGGCTGCTATTCCGGGAGGACAAGCCACCTATTTGGGGCAGCCAGTTCCTTGGGGCACATTACCTACAATTTTGGTGATTGAGTTTCTTGCTATTTCTTTCTTCAAGGAATACAAAATCAAAGAGGTTAAAAATGGTCGGCTAGCGATTTTGGCATTTGTTGGGTTCTGTGTGCAGCAATCAGCATACCCAGGGACAGGGCCATTGGAGAACTTGGCCTCTCACTTGGCTGACCCATGGCACAACAACATTGGCGATATCATCATCCCCAGAGGGTTGTAA 639 52.11 MASNTLMSCGIAAVAYPSVLSSSKSKFAASFALPSGYANASSRFSMSAEWMPGQPRPPYLDGSAPGDFGFDPLGLGSVPENLERFKESELIHCRWAMLAVPGVLIPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILVIEFLAISFFKEYKIKEVKNGRLAILAFVGFCVQQSAYPGTGPLENLASHLADPWHNNIGDIIIPRGL 212
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
14 2494774 2496171 + Bda027084.1 Bda14g00345 20396

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bda14g00345 212 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 22 154 IPR001344 GO:0009765|GO:0016020
Bda14g00345 212 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 6, CHLOROPLASTIC 155 205 - -
Bda14g00345 212 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 6, CHLOROPLASTIC 22 154 - -
Bda14g00345 212 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 155 205 IPR001344 GO:0009765|GO:0016020
Bda14g00345 212 Gene3D Chlorophyll a/b binding protein domain 155 209 - -
Bda14g00345 212 SUPERFAMILY Chlorophyll a-b binding protein 39 207 - -
Bda14g00345 212 Pfam Chlorophyll A-B binding protein 57 154 IPR022796 -
Bda14g00345 212 Pfam Chlorophyll A-B binding protein 154 179 IPR022796 -
Bda14g00345 212 Gene3D Chlorophyll a/b binding protein domain 51 154 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bda14g00345 K08907 LHCA1; light-harvesting complex I chlorophyll a/b binding protein 1 - pvy:116130060 374.785
       

WGDs- Genes


Select Gene_1 Gene_2 Event_name
Bda14g00345 Bda15g00170 CCT
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bda14g00345 Bda-Chr14:2494774 Bda03g01535 Bda-Chr3:54300923 2.30E-32 dispersed
Bda14g00345 Bda-Chr14:2494774 Bda15g00170 Bda-Chr15:4252509 1.31E-142 wgd
Bda14g00345 Bda-Chr14:2494774 Bda05g01028 Bda-Chr5:58739367 1.46E-32 wgd
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi13g497 . . . Bda15g00170 . Bpe15g01065 Bma03g00334 . . . . . . . . Cpe13g00808 . . . . . . . . . . . . . . . Cone1ag1346 Cone5ag0333 . . Lsi02g01721 . . . Blo13g00725 Blo04g00315 Bda14g00345 . Bpe04g01879 . . Bma08g00942 . Cmo04g02705 Cmo15g00458 Cma04g02584 Cma15g00450 Car04g02495 Car15g00417 . Cpe01g02245 . . . . . . . . . . . . . . . Csa05g01755 . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bda09g00155 . 1 345 Chloroplast and Mitochondria Gene Families AT2G28800 65.7 6.5e-116 414.5
Bda08g00695 . 5 256 Chloroplast and Mitochondria Gene Families AT1G15820 77.0 6.9e-113 403.7
Bda08g00696 . 5 256 Chloroplast and Mitochondria Gene Families AT1G15820 77.0 6.9e-113 403.7
Bda08g00723 . 5 256 Chloroplast and Mitochondria Gene Families AT1G15820 77.0 6.9e-113 403.7
Bda06g01104 . 3 254 Chloroplast and Mitochondria Gene Families AT1G15820 74.6 5.4e-110 394.0
Bda13g00597 BCT,CCT,ECH 1 267 Chloroplast and Mitochondria Gene Families AT3G27690 90.6 2.3e-144 508.4
Bda06g00422 BCT,CCT,ECH 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 90.6 5.1e-144 507.3
Bda15g00911 CCT,ECH 1 257 Chloroplast and Mitochondria Gene Families AT3G27690 90.3 5.5e-138 487.3
Bda14g01617 . 2 261 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 6.1e-121 430.6
Bda01g00815 . 2 263 Chloroplast and Mitochondria Gene Families AT3G27690 76.9 2.3e-120 428.7
Bda05g00187 . 3 262 Chloroplast and Mitochondria Gene Families AT3G27690 76.5 5.1e-120 427.6
Bda07g00940 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.3 2.5e-119 425.2
Bda07g00941 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 75.6 1.3e-118 422.9
Bda07g01813 . 13 231 Chloroplast and Mitochondria Gene Families AT3G27690 88.1 3.1e-117 418.3
Bda07g00942 . 13 231 Chloroplast and Mitochondria Gene Families AT3G27690 86.3 1.7e-115 412.5
Bda05g00395 . 10 232 Chloroplast and Mitochondria Gene Families AT3G27690 83.9 1.9e-114 409.1
Bda07g00273 . 7 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.0 5.0e-99 357.8
Bda09g00367 . 15 268 Chloroplast and Mitochondria Gene Families AT3G27690 67.0 1.0e-96 350.1
Bda07g00939 . 1 160 Chloroplast and Mitochondria Gene Families AT3G27690 85.6 3.6e-81 298.5
Bda05g00415 . 1 160 Chloroplast and Mitochondria Gene Families AT3G27690 84.4 1.8e-80 296.2
Bda11g00909 . 69 274 Chloroplast and Mitochondria Gene Families AT3G27690 52.1 3.9e-51 198.7
Bda03g01535 . 1 212 Chloroplast and Mitochondria Gene Families AT3G61470 87.7 2.9e-119 424.9
Bda03g01539 . 1 212 Chloroplast and Mitochondria Gene Families AT3G61470 87.7 2.9e-119 424.9
Bda05g01028 . 1 202 Chloroplast and Mitochondria Gene Families AT3G61470 88.1 7.3e-115 410.2
Bda06g00542 BCT 22 244 Chloroplast and Mitochondria Gene Families AT3G61470 53.4 1.1e-65 246.9
Bda15g00170 CCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.8 2.6e-89 325.1
Bda14g00345 CCT 1 161 Chloroplast and Mitochondria Gene Families AT3G54890 76.4 1.1e-66 250.0
Bda05g00930 . 4 282 Chloroplast and Mitochondria Gene Families AT3G08940 83.9 2.9e-136 481.5
Bda07g01019 . 1 281 Chloroplast and Mitochondria Gene Families AT3G08940 84.1 2.9e-136 481.5
Bda01g00152 . 1 303 Chloroplast and Mitochondria Gene Families AT3G08940 80.3 1.4e-135 479.2
Bda07g00716 . 1 272 Chloroplast and Mitochondria Gene Families AT1G61520 83.9 1.4e-132 469.2
Bda09g00283 . 1 272 Chloroplast and Mitochondria Gene Families AT1G61520 82.1 1.7e-130 462.2
Bda06g00422 BCT,CCT,ECH 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 90.6 5.9e-144 506.9
Bda13g00597 BCT,CCT,ECH 1 267 Chloroplast and Mitochondria Gene Families AT2G05070 89.9 1.5e-142 502.3
Bda15g00911 CCT,ECH 1 257 Chloroplast and Mitochondria Gene Families AT2G05070 89.9 1.6e-136 482.3
Bda01g00815 . 5 263 Chloroplast and Mitochondria Gene Families AT2G05070 77.7 4.1e-121 431.0
Bda14g01617 . 5 261 Chloroplast and Mitochondria Gene Families AT2G05070 78.4 1.6e-120 429.1
Bda07g00940 . 7 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.0 6.0e-120 427.2
Bda05g00187 . 6 262 Chloroplast and Mitochondria Gene Families AT2G05070 77.7 1.3e-119 426.0
Bda07g00941 . 7 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.3 3.0e-119 424.9
Bda07g01813 . 13 231 Chloroplast and Mitochondria Gene Families AT2G05070 87.7 6.8e-116 413.7
Bda07g00942 . 13 231 Chloroplast and Mitochondria Gene Families AT2G05070 86.3 3.4e-115 411.4
Bda05g00395 . 10 232 Chloroplast and Mitochondria Gene Families AT2G05070 83.9 3.7e-114 407.9
Bda09g00367 . 15 268 Chloroplast and Mitochondria Gene Families AT2G05070 68.4 1.1e-97 353.2
Bda07g00273 . 11 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 1.9e-97 352.4
Bda07g00939 . 1 160 Chloroplast and Mitochondria Gene Families AT2G05070 85.6 7.1e-81 297.4
Bda05g00415 . 1 160 Chloroplast and Mitochondria Gene Families AT2G05070 84.4 3.5e-80 295.0
Bda11g00909 . 69 274 Chloroplast and Mitochondria Gene Families AT2G05070 52.6 2.6e-51 199.1
Bda06g00422 BCT,CCT,ECH 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 91.1 7.9e-127 450.3
Bda15g00911 CCT,ECH 1 239 Chloroplast and Mitochondria Gene Families AT2G05100 90.8 6.7e-126 447.2
Bda13g00597 BCT,CCT,ECH 1 239 Chloroplast and Mitochondria Gene Families AT2G05100 90.8 6.7e-126 447.2
Bda01g00815 . 5 235 Chloroplast and Mitochondria Gene Families AT2G05100 75.8 2.3e-102 369.0
Bda14g01617 . 5 233 Chloroplast and Mitochondria Gene Families AT2G05100 76.3 8.8e-102 367.1
Bda07g00940 . 7 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.3 3.3e-101 365.2
Bda05g00187 . 6 234 Chloroplast and Mitochondria Gene Families AT2G05100 75.4 7.4e-101 364.0
Bda07g00941 . 7 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.4 1.7e-100 362.8
Bda07g01813 . 13 203 Chloroplast and Mitochondria Gene Families AT2G05100 86.9 1.0e-97 353.6
Bda07g00942 . 13 203 Chloroplast and Mitochondria Gene Families AT2G05100 85.3 5.0e-97 351.3
Bda05g00395 . 10 204 Chloroplast and Mitochondria Gene Families AT2G05100 82.6 5.5e-96 347.8
Bda07g00273 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 66.0 4.5e-82 301.6
Bda09g00367 . 15 240 Chloroplast and Mitochondria Gene Families AT2G05100 67.7 5.9e-82 301.2
Bda07g00939 . 1 132 Chloroplast and Mitochondria Gene Families AT2G05100 84.1 1.0e-62 237.3
Bda05g00415 . 1 132 Chloroplast and Mitochondria Gene Families AT2G05100 82.6 5.2e-62 235.0
Bda11g00909 . 69 258 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 3.2e-43 172.6
Bda05g00930 . 4 165 Chloroplast and Mitochondria Gene Families AT2G40100 69.6 3.6e-63 238.0
Bda07g01019 . 1 164 Chloroplast and Mitochondria Gene Families AT2G40100 69.0 6.1e-63 237.3
Bda01g00152 . 3 165 Chloroplast and Mitochondria Gene Families AT2G40100 68.8 1.0e-62 236.5
Bda07g00941 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 4.1e-137 484.2
Bda07g00940 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 4.6e-136 480.7
Bda01g00815 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 1.3e-135 479.2
Bda14g01617 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 3.3e-134 474.6
Bda05g00187 . 2 262 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 7.3e-134 473.4
Bda07g01813 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29930 91.4 5.3e-124 440.7
Bda05g00395 . 1 232 Chloroplast and Mitochondria Gene Families AT1G29930 89.7 2.0e-123 438.7
Bda07g00942 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29930 91.0 2.0e-123 438.7
Bda13g00597 BCT,CCT,ECH 35 267 Chloroplast and Mitochondria Gene Families AT1G29930 84.4 2.1e-117 418.7
Bda06g00422 BCT,CCT,ECH 29 265 Chloroplast and Mitochondria Gene Families AT1G29930 83.4 3.6e-117 417.9
Bda15g00911 CCT,ECH 35 257 Chloroplast and Mitochondria Gene Families AT1G29930 84.1 1.8e-111 399.1
Bda09g00367 . 50 268 Chloroplast and Mitochondria Gene Families AT1G29930 75.9 6.7e-95 344.0
Bda07g00273 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 75.0 1.1e-94 343.2
Bda07g00939 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29930 92.5 1.8e-84 309.3
Bda05g00415 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29930 91.3 9.1e-84 307.0
Bda11g00909 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29930 52.4 9.8e-54 207.2
Bda07g00941 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 1.6e-136 482.3
Bda07g00940 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 1.7e-135 478.8
Bda01g00815 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 5.1e-135 477.2
Bda14g01617 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 4.3e-134 474.2
Bda05g00187 . 2 262 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 9.6e-134 473.0
Bda07g01813 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29920 91.4 5.3e-124 440.7
Bda05g00395 . 1 232 Chloroplast and Mitochondria Gene Families AT1G29920 89.7 2.0e-123 438.7
Bda07g00942 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29920 91.0 2.0e-123 438.7
Bda13g00597 BCT,CCT,ECH 35 267 Chloroplast and Mitochondria Gene Families AT1G29920 84.4 2.1e-117 418.7
Bda06g00422 BCT,CCT,ECH 29 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.4 3.6e-117 417.9
Bda15g00911 CCT,ECH 35 257 Chloroplast and Mitochondria Gene Families AT1G29920 84.1 1.8e-111 399.1
Bda09g00367 . 50 268 Chloroplast and Mitochondria Gene Families AT1G29920 75.9 6.7e-95 344.0
Bda07g00273 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 75.0 1.1e-94 343.2
Bda07g00939 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29920 92.5 1.8e-84 309.3
Bda05g00415 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29920 91.3 9.1e-84 307.0
Bda11g00909 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29920 52.4 9.8e-54 207.2
Bda07g00941 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 1.6e-136 482.3
Bda07g00940 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 1.7e-135 478.8
Bda01g00815 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 5.1e-135 477.2
Bda14g01617 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 4.3e-134 474.2
Bda05g00187 . 2 262 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 9.6e-134 473.0
Bda07g01813 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29910 91.4 5.3e-124 440.7
Bda05g00395 . 1 232 Chloroplast and Mitochondria Gene Families AT1G29910 89.7 2.0e-123 438.7
Bda07g00942 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29910 91.0 2.0e-123 438.7
Bda13g00597 BCT,CCT,ECH 35 267 Chloroplast and Mitochondria Gene Families AT1G29910 84.4 2.1e-117 418.7
Bda06g00422 BCT,CCT,ECH 29 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.4 3.6e-117 417.9
Bda15g00911 CCT,ECH 35 257 Chloroplast and Mitochondria Gene Families AT1G29910 84.1 1.8e-111 399.1
Bda09g00367 . 50 268 Chloroplast and Mitochondria Gene Families AT1G29910 75.9 6.7e-95 344.0
Bda07g00273 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 75.0 1.1e-94 343.2
Bda07g00939 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29910 92.5 1.8e-84 309.3
Bda05g00415 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29910 91.3 9.1e-84 307.0
Bda11g00909 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29910 52.4 9.8e-54 207.2
Bda11g00909 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 84.9 3.2e-140 494.6
Bda05g00187 . 35 250 Chloroplast and Mitochondria Gene Families AT4G10340 51.4 2.6e-57 219.2
Bda14g01617 . 34 249 Chloroplast and Mitochondria Gene Families AT4G10340 51.4 2.6e-57 219.2
Bda07g01813 . 15 219 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 5.8e-57 218.0
Bda07g00940 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 9.9e-57 217.2
Bda07g00941 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 1.3e-56 216.9
Bda07g00942 . 15 219 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 1.3e-56 216.9
Bda01g00815 . 47 251 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 3.8e-56 215.3
Bda05g00395 . 16 220 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 4.9e-56 214.9
Bda06g00422 BCT,CCT,ECH 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 8.4e-56 214.2
Bda15g00911 CCT,ECH 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 1.4e-55 213.4
Bda13g00597 BCT,CCT,ECH 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 1.4e-55 213.4
Bda09g00367 . 50 256 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.6e-51 198.7
Bda07g00273 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 52.1 1.1e-50 197.2
Bda05g00415 . 1 148 Chloroplast and Mitochondria Gene Families AT4G10340 52.3 1.8e-37 153.3
Bda07g00939 . 1 148 Chloroplast and Mitochondria Gene Families AT4G10340 51.7 3.0e-37 152.5
Bda07g00941 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 2.5e-134 474.9
Bda07g00940 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 2.8e-133 471.5
Bda01g00815 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 8.0e-133 469.9
Bda14g01617 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 8.9e-132 466.5
Bda05g00187 . 2 262 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 2.6e-131 464.9
Bda07g01813 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34420 91.8 3.1e-124 441.4
Bda05g00395 . 1 232 Chloroplast and Mitochondria Gene Families AT2G34420 90.1 1.2e-123 439.5
Bda07g00942 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34420 91.4 1.2e-123 439.5
Bda13g00597 BCT,CCT,ECH 3 267 Chloroplast and Mitochondria Gene Families AT2G34420 76.2 2.1e-117 418.7
Bda06g00422 BCT,CCT,ECH 29 265 Chloroplast and Mitochondria Gene Families AT2G34420 83.0 8.1e-117 416.8
Bda15g00911 CCT,ECH 3 257 Chloroplast and Mitochondria Gene Families AT2G34420 75.7 1.7e-111 399.1
Bda09g00367 . 50 268 Chloroplast and Mitochondria Gene Families AT2G34420 76.4 8.7e-95 343.6
Bda07g00273 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 75.5 1.5e-94 342.8
Bda07g00939 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34420 93.2 1.1e-84 310.1
Bda05g00415 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34420 91.9 5.3e-84 307.8
Bda11g00909 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34420 52.4 1.7e-53 206.5
Bda07g00941 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 3.9e-135 477.6
Bda01g00815 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34430 89.1 8.6e-135 476.5
Bda07g00940 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.8 4.3e-134 474.2
Bda14g01617 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 2.8e-133 471.5
Bda05g00187 . 2 262 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 6.2e-133 470.3
Bda07g01813 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34430 90.9 3.4e-123 438.0
Bda07g00942 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34430 90.5 7.6e-123 436.8
Bda05g00395 . 1 232 Chloroplast and Mitochondria Gene Families AT2G34430 89.7 4.9e-122 434.1
Bda13g00597 BCT,CCT,ECH 35 267 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 4.0e-116 414.5
Bda06g00422 BCT,CCT,ECH 33 265 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 8.9e-116 413.3
Bda15g00911 CCT,ECH 35 257 Chloroplast and Mitochondria Gene Families AT2G34430 84.1 3.3e-110 394.8
Bda09g00367 . 50 268 Chloroplast and Mitochondria Gene Families AT2G34430 76.4 1.1e-94 343.2
Bda07g00273 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34430 75.5 1.9e-94 342.4
Bda07g00939 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34430 93.2 1.1e-84 310.1
Bda05g00415 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34430 91.9 5.3e-84 307.8
Bda11g00909 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34430 52.4 2.2e-53 206.1
Bda05g00930 . 2 282 Chloroplast and Mitochondria Gene Families AT5G01530 84.2 1.3e-139 492.7
Bda07g01019 . 4 281 Chloroplast and Mitochondria Gene Families AT5G01530 83.7 8.5e-136 479.9
Bda01g00152 . 1 303 Chloroplast and Mitochondria Gene Families AT5G01530 78.9 3.6e-134 474.6
Bda01g01310 BCT 263 522 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 3.8e-143 504.2
Bda13g01648 BCT 48 305 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 2.1e-141 498.4
Bda13g01648 BCT 1 305 Chloroplast and Mitochondria Gene Families AT3G27240 85.8 1.1e-149 526.2
Bda01g01310 BCT 235 522 Chloroplast and Mitochondria Gene Families AT3G27240 87.8 6.9e-144 506.9
Bda09g01563 . 5 323 Chloroplast and Mitochondria Gene Families AT2G30160 73.1 1.6e-138 489.2
Bda02g00881 . 1 323 Chloroplast and Mitochondria Gene Families AT2G30160 72.3 1.1e-134 476.5
Bda07g01026 . 4 319 Chloroplast and Mitochondria Gene Families AT2G30160 66.5 9.1e-118 420.2
Bda09g01563 . 1 323 Chloroplast and Mitochondria Gene Families AT1G07030 73.1 6.6e-137 483.8
Bda02g00881 . 1 323 Chloroplast and Mitochondria Gene Families AT1G07030 73.1 1.1e-136 483.0
Bda07g01026 . 8 319 Chloroplast and Mitochondria Gene Families AT1G07030 69.3 7.3e-120 427.2
Bda12g00080 . 1 311 Chloroplast and Mitochondria Gene Families AT2G47490 77.4 2.8e-137 485.0
Bda11g00163 BCT,CCT 17 325 Chloroplast and Mitochondria Gene Families AT2G47490 61.0 2.1e-108 389.0
Bda11g00163 BCT,CCT 25 320 Chloroplast and Mitochondria Gene Families AT1G25380 70.0 5.5e-116 414.5
Bda12g00080 . 16 297 Chloroplast and Mitochondria Gene Families AT1G25380 66.6 2.1e-107 386.0
Bda01g01793 . 1 583 Chloroplast and Mitochondria Gene Families AT4G21490 74.0 3.1e-254 874.4
Bda13g00644 BCT 1 586 Chloroplast and Mitochondria Gene Families AT4G21490 70.2 6.9e-238 820.1
Bda01g01745 . 331 792 Chloroplast and Mitochondria Gene Families AT4G21490 77.5 1.1e-211 733.0
Bda10g00865 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 63.2 1.6e-60 229.2
Bda08g01019 . 4 178 Chloroplast and Mitochondria Gene Families AT1G17530 52.5 1.1e-43 173.3
Bda08g01019 . 4 182 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 2.0e-45 179.1
Bda10g00865 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 52.6 1.9e-40 162.5
Bda10g00865 . 6 190 Chloroplast and Mitochondria Gene Families AT1G72750 66.7 6.2e-63 237.3
Bda08g01019 . 4 182 Chloroplast and Mitochondria Gene Families AT1G72750 53.8 1.8e-46 182.6
Bda01g02102 . 1 240 Chloroplast and Mitochondria Gene Families AT1G26100 64.9 4.4e-82 301.2
Bda13g01762 . 1 223 Chloroplast and Mitochondria Gene Families AT5G38630 72.3 4.7e-89 324.3
Bda07g01072 . 1 248 Chloroplast and Mitochondria Gene Families AT5G38630 63.1 1.0e-83 306.6
Bda15g00732 . 23 234 Chloroplast and Mitochondria Gene Families AT4G25570 61.8 7.1e-71 264.2
Bda01g01054 . 7 397 Chloroplast and Mitochondria Gene Families AT5G14040 75.5 3.7e-168 587.8
Bda11g01581 . 10 353 Chloroplast and Mitochondria Gene Families AT5G14040 79.4 3.3e-156 548.1
Bda01g01054 . 8 396 Chloroplast and Mitochondria Gene Families AT3G48850 64.6 1.9e-140 495.7
Bda11g01581 . 9 353 Chloroplast and Mitochondria Gene Families AT3G48850 69.4 1.0e-138 490.0
Bda11g01581 . 68 352 Chloroplast and Mitochondria Gene Families AT2G17270 50.9 7.0e-80 294.3
Bda12g00204 . 16 315 Chloroplast and Mitochondria Gene Families AT5G15640 74.5 2.5e-125 445.3
Bda07g01034 . 16 315 Chloroplast and Mitochondria Gene Families AT5G15640 73.8 6.9e-123 437.2
Bda03g00133 BCT 12 339 Chloroplast and Mitochondria Gene Families AT5G26200 66.8 1.2e-120 429.9
Bda01g00634 BCT 12 343 Chloroplast and Mitochondria Gene Families AT5G26200 64.5 2.7e-117 418.7
Bda10g00867 . 1 346 Chloroplast and Mitochondria Gene Families AT5G26200 61.2 2.4e-113 405.6
Bda10g00867 . 1 349 Chloroplast and Mitochondria Gene Families AT1G72820 76.4 2.5e-150 528.5
Bda03g00133 BCT 1 339 Chloroplast and Mitochondria Gene Families AT1G72820 67.6 8.1e-125 443.7
Bda01g00634 BCT 1 344 Chloroplast and Mitochondria Gene Families AT1G72820 66.6 9.9e-123 436.8
Bda07g00490 . 99 303 Chloroplast and Mitochondria Gene Families AT5G52570 52.7 5.2e-51 198.0
Bda07g01901 . 599 772 Chloroplast and Mitochondria Gene Families AT5G52570 51.1 1.6e-39 159.8
Bda07g00490 . 49 221 Chloroplast and Mitochondria Gene Families AT4G25700 61.5 2.2e-59 225.7
Bda07g01901 . 599 688 Chloroplast and Mitochondria Gene Families AT4G25700 88.9 1.3e-43 173.3
Bda01g01934 . 29 459 Chloroplast and Mitochondria Gene Families AT2G18710 88.2 1.1e-216 749.6
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0005279 2 1 2 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 2 1 1 1 1 1 40
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bda14g00345 Bda_Chr14 FPKM 23.351139 26.257734 40.897564 35.725727 2.213284 2.815674 2.885781 50.045494 45.948261