Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bda14g01003 ATGAATGATCTAATGACAAAATCGTTCTTAAGTTATGTGGAATTGAAGAAACAAGCAATGAAAGACATGGAAGCCCATCCCGACATAGAAACAGGCCAACTCAATCCTGCCGTTGAACATAATCTCTCCAAGTTCTTTGAAGAAGCGGGCAAAGTCAAAACTGAAATGGAAGAGATCAGCAATCTCTTGATCGAACTTCAAACACTCAATGAGGAGGCAAAGTCCATTTTCAGCGCCAAGATTCTTGGTGGGATAAGAGATCGAATGGATTCAAACATGGTTTCAATCCTTCGCAAAGCAAAGACGGTGAAGTCTAGGCTGGAAGCACTCGATCGATCCAACCTAAAAAATCGAAGAAATTCAGAAGCCTTTAAAGAAAGCAGTCATGTTGACAGAACCAGGATTTCTGTCACTAACGGTTTAAGAGTCAAGCTGAGAGAATTAATGAATGATTTTCAGTTCTTGAGAGAGAAAATTCTACGTGATCATAAGGAAGACCTAAGGAGGACGTACTACACTGCAACAGGCGAGCAACTGAGTGAGGAAGTGATTGAGAAAATAGTCATGGGGGGCGAGAGAATTGACTTATTTCAGGGTAATCAAGCCAGGCACCAGGCTGTTTTAGAGGTTCAGAGGAGCTTGAGCAAGCTTCATCAGGTTTTTCTCGACATGGCTGTGCTTGTTGAGACGCAGGGAGAAAAAATGAATGACATTGAGGAGAATGTAGCTAATGCAAGAGGCTCCATCAATGGCGGAACTAATAGTCTTTACTATGCCAATCAGACTAAGAAAAACAAGAAATGGGCGTACTGGGTTGCAGCTGTTGTACTGATCATAGTGCTGGTTTGCTTCATAGCTACACTAGTTTCTTGA 873 42.04 MNDLMTKSFLSYVELKKQAMKDMEAHPDIETGQLNPAVEHNLSKFFEEAGKVKTEMEEISNLLIELQTLNEEAKSIFSAKILGGIRDRMDSNMVSILRKAKTVKSRLEALDRSNLKNRRNSEAFKESSHVDRTRISVTNGLRVKLRELMNDFQFLREKILRDHKEDLRRTYYTATGEQLSEEVIEKIVMGGERIDLFQGNQARHQAVLEVQRSLSKLHQVFLDMAVLVETQGEKMNDIEENVANARGSINGGTNSLYYANQTKKNKKWAYWVAAVVLIIVLVCFIATLVS 290
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
14 8450716 8451588 + Bda027812.1 Bda14g01003 21054

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bda14g01003 290 CDD SNARE_syntaxin1-like 201 256 - -
Bda14g01003 290 CDD SynN 42 194 IPR006011 GO:0016020
Bda14g01003 290 SMART SynN_4 37 164 IPR006011 GO:0016020
Bda14g01003 290 Gene3D - 38 167 - -
Bda14g01003 290 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 197 259 IPR000727 -
Bda14g01003 290 Coils Coil 52 72 - -
Bda14g01003 290 PANTHER SYNTAXIN 3 286 IPR045242 -
Bda14g01003 290 SUPERFAMILY t-snare proteins 40 252 IPR010989 GO:0016020|GO:0016192
Bda14g01003 290 PANTHER SYNTAXIN-112 3 286 - -
Bda14g01003 290 Pfam Syntaxin 44 198 IPR006011 GO:0016020
Bda14g01003 290 Pfam Syntaxin 201 232 IPR006011 GO:0016020
Bda14g01003 290 Gene3D - 194 290 - -
Bda14g01003 290 SMART tSNARE_6 192 259 IPR000727 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bda14g01003 K08486 STX1B_2_3; syntaxin 1B/2/3 - jre:108997509 383.259
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bda08g00943 Bda-Chr8:17704860 Bda14g01003 Bda-Chr14:8450716 7.11E-09 dispersed
Bda14g01003 Bda-Chr14:8450716 Bda09g01276 Bda-Chr9:44512231 8.26E-64 dispersed
Bda06g00929 Bda-Chr6:25095255 Bda14g01003 Bda-Chr14:8450716 4.15E-128 transposed
Bda11g01860 Bda-Chr11:53717274 Bda14g01003 Bda-Chr14:8450716 8.94E-168 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bda13g01286 . 440 803 SNARE and Associated Proteins AT3G24350 59.5 1.5e-97 353.2
Bda01g00978 . 1 341 SNARE and Associated Proteins AT3G24350 61.5 9.0e-95 344.0
Bda11g01860 . 1 294 SNARE and Associated Proteins AT2G18260 55.0 5.7e-82 301.2
Bda14g01003 . 1 290 SNARE and Associated Proteins AT2G18260 55.0 1.4e-80 296.6
Bda06g00929 . 1 293 SNARE and Associated Proteins AT2G18260 51.8 1.6e-76 283.1
Bda05g01127 . 22 278 SNARE and Associated Proteins AT3G11820 78.6 1.9e-109 392.5
Bda03g00658 . 19 279 SNARE and Associated Proteins AT3G11820 74.3 2.6e-106 382.1
Bda01g00422 . 19 279 SNARE and Associated Proteins AT3G11820 71.6 1.9e-101 365.9
Bda01g00430 . 19 279 SNARE and Associated Proteins AT3G11820 71.6 1.9e-101 365.9
Bda09g01276 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 5.7e-93 337.8
Bda03g00659 . 19 238 SNARE and Associated Proteins AT3G11820 57.1 5.3e-67 251.5
Bda02g00552 . 31 159 SNARE and Associated Proteins AT3G11820 56.6 6.8e-38 154.8
Bda03g00658 . 1 279 SNARE and Associated Proteins AT3G52400 62.5 5.4e-89 324.7
Bda01g00422 . 1 279 SNARE and Associated Proteins AT3G52400 61.2 8.6e-87 317.4
Bda01g00430 . 1 279 SNARE and Associated Proteins AT3G52400 61.2 8.6e-87 317.4
Bda05g01127 . 29 278 SNARE and Associated Proteins AT3G52400 66.4 2.1e-85 312.8
Bda09g01276 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 2.0e-80 296.2
Bda09g01276 . 1 299 SNARE and Associated Proteins AT4G03330 67.9 3.0e-107 385.2
Bda03g00658 . 1 279 SNARE and Associated Proteins AT4G03330 56.1 1.3e-78 290.0
Bda05g01127 . 1 282 SNARE and Associated Proteins AT4G03330 53.4 2.9e-78 288.9
Bda01g00422 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 3.6e-76 282.0
Bda01g00430 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 3.6e-76 282.0
Bda02g00552 . 1 159 SNARE and Associated Proteins AT4G03330 63.6 3.7e-49 192.2
Bda03g00659 . 1 201 SNARE and Associated Proteins AT4G03330 52.6 1.4e-48 190.3
Bda09g01276 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 1.5e-122 436.0
Bda03g00658 . 1 279 SNARE and Associated Proteins AT1G61290 59.1 3.5e-84 308.5
Bda05g01127 . 1 277 SNARE and Associated Proteins AT1G61290 58.6 2.3e-83 305.8
Bda01g00422 . 1 294 SNARE and Associated Proteins AT1G61290 54.7 4.8e-81 298.1
Bda01g00430 . 1 294 SNARE and Associated Proteins AT1G61290 54.7 4.8e-81 298.1
Bda02g00552 . 1 159 SNARE and Associated Proteins AT1G61290 74.2 2.7e-60 229.2
Bda09g01276 . 1 303 SNARE and Associated Proteins AT1G11250 75.6 4.3e-119 424.5
Bda03g00658 . 1 279 SNARE and Associated Proteins AT1G11250 60.9 3.0e-88 322.0
Bda05g01127 . 1 278 SNARE and Associated Proteins AT1G11250 59.4 1.2e-87 320.1
Bda01g00422 . 1 284 SNARE and Associated Proteins AT1G11250 57.7 3.5e-84 308.5
Bda01g00430 . 1 284 SNARE and Associated Proteins AT1G11250 57.7 3.5e-84 308.5
Bda02g00552 . 1 159 SNARE and Associated Proteins AT1G11250 70.4 1.2e-55 213.8
Bda06g00358 . 1 307 SNARE and Associated Proteins AT3G03800 63.2 3.4e-95 345.1
Bda06g00358 . 1 204 SNARE and Associated Proteins AT5G08080 62.3 7.1e-58 220.7
Bda06g01261 BCT 1 263 SNARE and Associated Proteins AT5G16830 63.2 5.9e-78 287.7
Bda06g01264 . 1 263 SNARE and Associated Proteins AT5G16830 63.2 2.3e-77 285.8
Bda08g00639 BCT 1 263 SNARE and Associated Proteins AT5G16830 62.5 9.5e-76 280.4
Bda08g00639 BCT 1 274 SNARE and Associated Proteins AT5G46860 70.4 5.3e-84 307.8
Bda06g01264 . 1 263 SNARE and Associated Proteins AT5G46860 70.0 5.9e-83 304.3
Bda06g01261 BCT 1 263 SNARE and Associated Proteins AT5G46860 69.6 6.5e-82 300.8
Bda08g00639 BCT 1 257 SNARE and Associated Proteins AT4G17730 66.5 1.1e-76 283.5
Bda06g01264 . 1 257 SNARE and Associated Proteins AT4G17730 64.2 5.8e-75 277.7
Bda06g01261 BCT 1 257 SNARE and Associated Proteins AT4G17730 64.2 2.2e-74 275.8
Bda01g01045 . 1 184 SNARE and Associated Proteins AT4G17730 54.0 1.2e-43 173.7
Bda13g01915 . 1 176 SNARE and Associated Proteins AT4G17730 53.1 4.2e-41 165.2
Bda08g00639 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 3.2e-49 192.6
Bda06g01261 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 4.2e-49 192.2
Bda06g01264 . 65 256 SNARE and Associated Proteins AT1G32270 58.3 4.2e-49 192.2
Bda14g00262 . 1 337 SNARE and Associated Proteins AT5G05760 65.5 2.0e-112 402.5
Bda13g01286 . 440 803 SNARE and Associated Proteins AT3G24350 59.5 1.5e-97 353.2
Bda01g00978 . 1 341 SNARE and Associated Proteins AT3G24350 61.5 9.0e-95 344.0
Bda01g01644 . 1 341 SNARE and Associated Proteins AT5G26980 75.4 2.6e-125 445.3
Bda01g01638 . 1 341 SNARE and Associated Proteins AT5G26980 75.4 2.6e-125 445.3
Bda08g01094 . 16 263 SNARE and Associated Proteins AT5G26980 78.6 7.3e-96 347.4
Bda01g01644 . 1 339 SNARE and Associated Proteins AT4G02195 63.9 2.6e-101 365.5
Bda01g01638 . 1 339 SNARE and Associated Proteins AT4G02195 63.9 2.6e-101 365.5
Bda08g01094 . 16 261 SNARE and Associated Proteins AT4G02195 67.6 6.4e-84 307.8
Bda01g01644 . 1 339 SNARE and Associated Proteins AT3G05710 75.2 4.8e-127 451.1
Bda01g01638 . 1 339 SNARE and Associated Proteins AT3G05710 75.2 4.8e-127 451.1
Bda08g01094 . 17 261 SNARE and Associated Proteins AT3G05710 82.0 4.5e-101 364.8
Bda09g00411 BCT,CCT 1 232 SNARE and Associated Proteins AT1G16240 72.4 6.2e-89 323.9
Bda05g00693 CCT 1 234 SNARE and Associated Proteins AT1G16240 60.3 9.7e-74 273.5
Bda07g00381 BCT,CCT 1 195 SNARE and Associated Proteins AT1G16240 70.8 5.9e-71 264.2
Bda09g00411 BCT,CCT 1 232 SNARE and Associated Proteins AT1G79590 70.4 2.8e-85 312.0
Bda05g00693 CCT 1 233 SNARE and Associated Proteins AT1G79590 61.4 1.9e-73 272.7
Bda07g00381 BCT,CCT 1 195 SNARE and Associated Proteins AT1G79590 69.7 1.3e-71 266.5
Bda09g00403 . 63 264 SNARE and Associated Proteins AT1G28490 67.3 7.6e-67 250.4
Bda07g00367 . 55 226 SNARE and Associated Proteins AT1G28490 60.6 2.8e-53 205.3
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G09740 56.4 1.6e-80 296.2
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G45280 56.4 1.1e-78 290.0
Bda02g00767 . 1 286 SNARE and Associated Proteins AT3G61450 52.3 9.8e-75 276.9
Bda14g00163 . 65 263 SNARE and Associated Proteins AT1G51740 65.5 1.3e-65 246.5
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002433 5 3 5 4 2 1 2 1 2 2 1 1 2 1 2 1 1 3 2 1 2 3 2 2 1 1 1 2 1 4 61
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bda14g01003 Bda_Chr14 FPKM 107.835396 112.508469 70.600204 71.818329 45.665443 46.571957 45.235741 107.566513 99.669273