Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bhi01g01117 TGACTGCTGGAAAGGTCTAACCGTACCAAGTTCTCTTTGCTTTCCTTTTCCTTTTCCTTTTCCTTTCTCAATTCTGGTTGAAAGAGCAAGCTGAAGAAGAAGCTCAAACGTGGTGGCCGTAGCTATAGCCTTACGTATATAGCTTTGTGATCACGGAACCGAAGCGCCAGATCAATGGCTCTCGACGTCGAAGCTGCACCAGCGGCGGAGTTGGCGCTTGCTGATACCGACATCAACTGGAACAGGTTGGACAAGACAAAGTTTCATATAATTGGGGCAATACTCTTTACGGCTCAGTCAGCCTTGTTACATCCAACAGCAGTTGTAAAAACTAGAATGCAAGTTGCTGGATCTGGTCTATCTCACATGCGTGGACTGTCAGTTTTCTGGACTATATTGAAGTCTGATGGAATCTCTGGCTTGTATAGAGGTTTTGGTACTTCAGCGCTTGGATCATTACCTGGTAGAGTACTGGCTTTAACATCACTAGAAGTATCAAAAGACATCATGTTGAAATATACTGGAAACCTGGAAATGCCTGAAGCAACACGTGTTGGTCTTGCTAATGGAGTGGCAGGCATGATCTCAAATTTAGTTTCATGCATATACTATGTACCATTGGACGTGACTTGCCAGAGGCTGATGGTTCAAGGGCTTCCTGGAACTACCTTCTGCAATGGCCCACTTGATGTTGTCAAAAAAGTGATGAAGGCTGAAGGATTTCGTGGTTTATATAGGGGTTTTGGATTAACGGCTGTAACTCAGTCGCCAGCATCTGCTCTCTGGTGGGGTGTTTATGGTGCTGCTCAGCATATTATCTGGAGGAGCTTAGGATATCGAGATAGCATGGAGAAGAAACCTTCTCACATGGAGATGGTGACGGTTCAGGCCACAGCAGGAATGGTGGCAGGTGCTTGTTCCTCTGTGATTACAACTCCCGTAGACACAGTAAAGACGCGACTTCAGGTCATCGATAACTATGGAATTGGAAGACCATCCGTGCTCAAGACTTCAAGAGCACTTCTCAAGGAAGATGGATGGTTGGGATTTTATAGAGGCTTTGGACCTCGGTTTTTGAATATGTCTCTTTATGGAACCACGATGATAGTCACTTATGAACTGATCAAGAGACTTTCGTTAAGGACATCGTGACATCTTGAACGGGAGGACATGCGGGACATTTAGAATGAATAGAACAGCTTCTTGCATTCTTGAATTCTCCAACCCACCCTAAAAAAGGGTTGAATTGGTGACTCATTAACCTTTCGGCAATGCAAAACTTAAGCTTCTCCTATCCATGGCCACCTTATAACTGCAGGGTTGAATTCC 1329 44.77 MALDVEAAPAAELALADTDINWNRLDKTKFHIIGAILFTAQSALLHPTAVVKTRMQVAGSGLSHMRGLSVFWTILKSDGISGLYRGFGTSALGSLPGRVLALTSLEVSKDIMLKYTGNLEMPEATRVGLANGVAGMISNLVSCIYYVPLDVTCQRLMVQGLPGTTFCNGPLDVVKKVMKAEGFRGLYRGFGLTAVTQSPASALWWGVYGAAQHIIWRSLGYRDSMEKKPSHMEMVTVQATAGMVAGACSSVITTPVDTVKTRLQVIDNYGIGRPSVLKTSRALLKEDGWLGFYRGFGPRFLNMSLYGTTMIVTYELIKRLSLRTS 325
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
1 21808831 21812543 + XM_039021388.1 Bhi01g01117 23890

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bhi01g01117 325 ProSiteProfiles Solute carrier (Solcar) repeat profile. 233 320 IPR018108 -
Bhi01g01117 325 SUPERFAMILY Mitochondrial carrier 23 316 IPR023395 -
Bhi01g01117 325 Pfam Mitochondrial carrier protein 32 115 IPR018108 -
Bhi01g01117 325 Pfam Mitochondrial carrier protein 237 321 IPR018108 -
Bhi01g01117 325 Pfam Mitochondrial carrier protein 130 216 IPR018108 -
Bhi01g01117 325 PANTHER MITOCHONDRIAL SUBSTRATE CARRIER FAMILY PROTEIN J 1 323 - -
Bhi01g01117 325 PANTHER OS01G0329400 PROTEIN 1 323 - -
Bhi01g01117 325 Gene3D Mitochondrial carrier domain 123 324 IPR023395 -
Bhi01g01117 325 ProSiteProfiles Solute carrier (Solcar) repeat profile. 26 111 IPR018108 -
Bhi01g01117 325 ProSiteProfiles Solute carrier (Solcar) repeat profile. 126 214 IPR018108 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bhi01g01117 K15121 SLC25A44; solute carrier family 25, member 44 - csv:101213375 618.616
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bhi01g01117 Bhi-Chr1:21808831 Bhi06g00306 Bhi-Chr6:6905404 1.08E-108 dispersed
Bhi01g01116 Bhi-Chr1:21808831 Bhi01g01117 Bhi-Chr1:21808831 0 tandem
Bhi01g01117 Bhi-Chr1:21808831 Bhi01g01118 Bhi-Chr1:21808831 0 tandem
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bhi08g00625 . 1 399 Chloroplast and Mitochondria Gene Families AT2G28800 64.4 2.3e-137 486.5
Bhi04g00600 . 71 423 Chloroplast and Mitochondria Gene Families AT2G28800 55.3 2.5e-99 360.1
Bhi04g01789 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.0 2.2e-119 426.0
Bhi05g01456 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.1 1.9e-143 506.1
Bhi10g00982 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.0 2.3e-120 429.5
Bhi03g00049 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 8.7e-120 427.6
Bhi03g00050 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 1.1e-119 427.2
Bhi11g01312 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 5.6e-119 424.9
Bhi11g00737 . 1 162 Chloroplast and Mitochondria Gene Families AT3G27690 73.6 2.8e-62 236.5
Bhi09g02763 . 123 339 Chloroplast and Mitochondria Gene Families AT3G27690 51.2 9.2e-53 204.9
Bhi06g00098 . 73 276 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.7e-51 200.7
Bhi07g01927 . 36 273 Chloroplast and Mitochondria Gene Families AT3G61470 85.8 5.4e-126 448.0
Bhi02g00306 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 7.6e-64 241.5
Bhi02g01759 . 56 217 Chloroplast and Mitochondria Gene Families AT3G61470 52.4 2.7e-61 233.0
Bhi08g01147 . 56 245 Chloroplast and Mitochondria Gene Families AT3G61470 55.6 4.6e-61 232.3
Bhi06g00641 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 8.8e-90 327.4
Bhi03g02124 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 83.0 7.1e-135 477.6
Bhi11g01849 . 2 278 Chloroplast and Mitochondria Gene Families AT3G08940 84.5 3.9e-133 471.9
Bhi09g02763 . 15 346 Chloroplast and Mitochondria Gene Families AT1G76570 72.7 3.6e-143 505.4
Bhi09g02762 . 15 297 Chloroplast and Mitochondria Gene Families AT1G76570 61.3 2.9e-108 389.4
Bhi02g01410 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.4 4.6e-136 481.5
Bhi05g01456 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.1 2.9e-143 505.4
Bhi03g00049 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 4.5e-120 428.3
Bhi03g00050 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 5.9e-120 427.9
Bhi10g00982 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 2.3e-119 426.0
Bhi11g01312 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.5 1.9e-118 422.9
Bhi11g00737 . 1 162 Chloroplast and Mitochondria Gene Families AT2G05070 74.2 2.5e-62 236.5
Bhi06g00098 . 73 276 Chloroplast and Mitochondria Gene Families AT2G05070 53.1 1.2e-51 201.1
Bhi09g02763 . 123 339 Chloroplast and Mitochondria Gene Families AT2G05070 50.2 2.6e-51 199.9
Bhi05g01456 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.0 1.6e-124 443.4
Bhi03g00049 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 2.5e-101 366.3
Bhi03g00050 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 4.3e-101 365.5
Bhi10g00982 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 1.6e-100 363.6
Bhi11g01312 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.4 1.6e-100 363.6
Bhi11g00737 . 1 134 Chloroplast and Mitochondria Gene Families AT2G05100 73.3 1.4e-46 184.5
Bhi06g00098 . 73 260 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 4.1e-43 172.9
Bhi03g02124 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 73.4 3.1e-67 252.3
Bhi11g01849 . 2 164 Chloroplast and Mitochondria Gene Families AT2G40100 69.6 3.0e-62 235.7
Bhi10g00982 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 2.0e-136 482.6
Bhi03g00050 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 2.3e-135 479.2
Bhi03g00049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 5.0e-135 478.0
Bhi11g01312 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.9 8.6e-127 450.7
Bhi05g01456 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29930 82.9 1.5e-115 413.3
Bhi11g00737 . 1 162 Chloroplast and Mitochondria Gene Families AT1G29930 71.8 9.7e-62 234.6
Bhi10g00982 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 7.8e-136 480.7
Bhi03g00050 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 8.6e-135 477.2
Bhi03g00049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 1.9e-134 476.1
Bhi11g01312 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.9 1.1e-126 450.3
Bhi05g01456 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29920 82.9 1.5e-115 413.3
Bhi11g00737 . 1 162 Chloroplast and Mitochondria Gene Families AT1G29920 71.8 9.7e-62 234.6
Bhi06g00098 . 56 276 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 1.1e-52 204.5
Bhi10g00982 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 7.8e-136 480.7
Bhi03g00050 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 8.6e-135 477.2
Bhi03g00049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 1.9e-134 476.1
Bhi11g01312 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.9 1.1e-126 450.3
Bhi05g01456 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29910 82.9 1.5e-115 413.3
Bhi11g00737 . 1 162 Chloroplast and Mitochondria Gene Families AT1G29910 71.8 9.7e-62 234.6
Bhi06g00098 . 56 276 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 1.1e-52 204.5
Bhi06g00098 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 85.1 2.7e-139 492.3
Bhi03g00049 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 7.5e-57 218.4
Bhi03g00050 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 7.5e-57 218.4
Bhi11g01312 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.7e-56 217.2
Bhi10g00982 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 3.7e-56 216.1
Bhi05g01456 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 4.6e-54 209.1
Bhi10g00982 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.3e-135 479.9
Bhi03g00050 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 9.4e-134 473.8
Bhi03g00049 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 2.1e-133 472.6
Bhi11g01312 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.3 1.7e-127 453.0
Bhi05g01456 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.4 6.8e-116 414.5
Bhi11g00737 . 1 162 Chloroplast and Mitochondria Gene Families AT2G34420 72.4 9.6e-62 234.6
Bhi03g00050 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.7 7.0e-137 484.2
Bhi03g00049 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 2.7e-136 482.3
Bhi10g00982 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 2.2e-135 479.2
Bhi11g01312 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.6 2.4e-129 459.1
Bhi05g01456 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 6.4e-114 407.9
Bhi11g00737 . 1 162 Chloroplast and Mitochondria Gene Families AT2G34430 72.4 9.6e-62 234.6
Bhi11g01849 . 2 278 Chloroplast and Mitochondria Gene Families AT5G01530 86.7 4.8e-139 491.5
Bhi03g02124 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 84.2 8.1e-139 490.7
Bhi11g00879 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 92.7 8.3e-143 503.8
Bhi11g00878 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 92.7 8.3e-143 503.8
Bhi11g00880 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 92.7 8.3e-143 503.8
Bhi11g00879 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.7 1.6e-148 523.1
Bhi11g00878 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.7 1.6e-148 523.1
Bhi11g00880 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.7 1.6e-148 523.1
Bhi10g00847 . 5 329 Chloroplast and Mitochondria Gene Families AT2G30160 75.2 5.6e-144 508.1
Bhi03g02177 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 64.8 7.4e-112 401.4
Bhi10g00847 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.1 3.0e-142 502.3
Bhi03g02177 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.8 8.0e-119 424.5
Bhi09g00933 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.7 1.4e-136 483.4
Bhi12g00835 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 64.5 9.1e-112 401.0
Bhi12g00835 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 64.3 1.7e-122 436.8
Bhi09g00933 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.5 1.3e-106 384.0
Bhi08g01904 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 74.9 2.9e-260 895.2
Bhi10g01180 CCT 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 68.9 4.3e-240 828.2
Bhi05g01823 CCT 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.0 1.8e-222 769.6
Bhi09g00363 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.4 1.7e-62 236.5
Bhi02g01229 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 57.9 1.2e-50 197.2
Bhi02g01229 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 58.4 9.2e-51 197.6
Bhi09g00363 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.6 8.4e-44 174.5
Bhi09g00363 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.6 8.6e-65 244.2
Bhi02g01229 . 1 183 Chloroplast and Mitochondria Gene Families AT1G72750 57.4 9.9e-53 204.1
Bhi07g01380 . 1 223 Chloroplast and Mitochondria Gene Families AT1G26100 60.5 9.4e-69 257.7
Bhi06g00067 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 6.6e-91 331.3
Bhi05g00612 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 74.0 3.6e-83 305.8
Bhi12g00971 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 53.7 7.1e-66 248.1
Bhi12g01081 . 9 367 Chloroplast and Mitochondria Gene Families AT5G14040 80.4 5.7e-169 591.3
Bhi02g00641 . 37 327 Chloroplast and Mitochondria Gene Families AT5G14040 85.9 1.9e-148 523.1
Bhi05g01557 . 13 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 1.3e-83 307.8
Bhi01g02007 . 2 207 Chloroplast and Mitochondria Gene Families AT5G14040 57.7 1.1e-63 241.5
Bhi12g01081 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 71.2 4.3e-145 511.9
Bhi02g00641 . 10 349 Chloroplast and Mitochondria Gene Families AT3G48850 65.5 1.5e-134 476.9
Bhi05g01557 . 13 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.9 1.2e-83 307.8
Bhi01g02007 . 2 206 Chloroplast and Mitochondria Gene Families AT3G48850 59.7 1.3e-64 244.6
Bhi05g01557 . 14 309 Chloroplast and Mitochondria Gene Families AT2G17270 75.7 2.5e-130 462.6
Bhi12g01081 . 62 364 Chloroplast and Mitochondria Gene Families AT2G17270 52.1 1.1e-85 314.3
Bhi06g00306 . 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 76.5 2.3e-131 466.1
Bhi01g01118 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.7 3.2e-80 296.2
Bhi01g01117 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.7 3.2e-80 296.2
Bhi01g01116 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.7 3.2e-80 296.2
Bhi09g03099 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.8e-124 443.4
Bhi09g03101 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.8e-124 443.4
Bhi09g03096 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.8e-124 443.4
Bhi09g03097 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.8e-124 443.4
Bhi09g03098 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.8e-124 443.4
Bhi09g03102 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.8e-124 443.4
Bhi09g03100 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.8e-124 443.4
Bhi09g00350 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 57.6 2.0e-104 376.7
Bhi09g00350 . 1 351 Chloroplast and Mitochondria Gene Families AT1G72820 75.1 1.5e-147 520.0
Bhi09g03099 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 1.7e-130 463.4
Bhi09g03101 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 1.7e-130 463.4
Bhi09g03096 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 1.7e-130 463.4
Bhi09g03097 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 1.7e-130 463.4
Bhi09g03098 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 1.7e-130 463.4
Bhi09g03102 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 1.7e-130 463.4
Bhi09g03100 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 1.7e-130 463.4
Bhi12g00299 . 79 284 Chloroplast and Mitochondria Gene Families AT5G52570 51.0 3.3e-50 196.1
Bhi12g00299 . 26 201 Chloroplast and Mitochondria Gene Families AT4G25700 57.0 7.4e-55 211.5
Bhi12g00298 . 26 201 Chloroplast and Mitochondria Gene Families AT4G25700 57.0 7.4e-55 211.5
Bhi11g00735 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 1.6e-120 430.3
Bhi11g00734 . 104 366 Chloroplast and Mitochondria Gene Families AT5G54290 84.8 4.6e-120 428.7
Bhi02g00813 . 52 546 Chloroplast and Mitochondria Gene Families AT2G18710 84.9 5.9e-239 824.3
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002174 2 4 1 1 1 2 3 2 2 2 2 1 4 2 2 3 2 3 3 1 2 2 2 2 2 2 2 2 3 2 64
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bhi01g01117 Bhi_Chr01 FPKM 68.462357 73.224396 36.861195 38.25013 69.088394 65.476479 69.591202 90.109459 91.456039 92.404015