Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bhi02g01339 GCCTCCGTTTTGGTTTTGGAGTTCTTGATGGGAGTCCTAAACACCTTCGAGATTTTGCTATATATACATTAGATTTTCGATTCATCGCTAAGTTTTCGCAGATTCCCCTTCTTCTCTTCCCCGATTCTCTGCAATTTTTCTGTTCTTCAATCCATCAATCCTTCACAATAATGAGGCTCCAAGTCGCCGACGACGATCTCGACGCCATTCTTCTTCCTCCGCCGAACTTCTCCATGGTTGAGGACGGCATTTTCCGATCCGGCTTCCCTCAACCCGCCAATTTCCCCTTCCTCCGCAGCCTCAATCTCCGCTCCATCATATATTTGTGTCCTGAACCCTACCCTGAGGAGAATTTGGAGTTTCTTAAAGCTAATAATATCAAGCTTTTTCAATTCAAAATTGAAGGCAAAAAGGAGCCTTTCGTTTCGATTCCGAAGGATGCTATTCTTGAGGCTCTAAAAATACTAATTGATGTTAGGAATCACCCCATTTTGATCCACTGCAAGCGTGGAAAGCATCGAACAGGCTCGCTCGTGGGTTGCCTGAGGAAGTTTCAGAACTGGTGTTTGACTTCGGTGTTCGAAGAGTACCAGCGATTTGCAGGCATGAAATCGAGGGTGACGGATCTACAATTCATCGAGACATTCGACATTGCGTCTCTGAGGCAATGTGTTTACAGCATCATATATCAGTACCAAGGTTATAGCTCAAACAAGAGGAGGCTGTTGTATAGAGAAGAAAACTTGCAAAAGCCTCAAACAACATCAGTTTAGAAGAAAATTTCAATCCATACAAGAACTCAACCTTCTTTAATGCACATAATATCAAGTTCTTGTCAAACCATCAAGTCTATGGTTCCCCATTTTTTGGGTCCCATTGATTGCTCAGATCCTATTTTTTTTTCCCTTTTTTCTTTTTTTGTTTTATCATTTTTTTTTGCTTTTTTCTTATTCATAAGAAATTAAAAAAAGGAAAAAGAAGGAAAAAGAATAGCAAACTTTATGGAAACTATTATTTCCTTAGTCATAGAAGTTCAAGAATAGCTTCATCTGATTGATTGTTTTTTTATGTATAGTTTCATTGGATACTTGTTATTTACTGAGAATCATATATTTAGATTATTATTTTTTTTTACAA 1137 38.43 MRLQVADDDLDAILLPPPNFSMVEDGIFRSGFPQPANFPFLRSLNLRSIIYLCPEPYPEENLEFLKANNIKLFQFKIEGKKEPFVSIPKDAILEALKILIDVRNHPILIHCKRGKHRTGSLVGCLRKFQNWCLTSVFEEYQRFAGMKSRVTDLQFIETFDIASLRQCVYSIIYQYQGYSSNKRRLLYREENLQKPQTTSV 200
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 33532619 33534707 - XM_039023779.1 Bhi02g01339 27861

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bhi02g01339 200 PRINTS Plant and fungal dual specificity phosphatase signature 14 31 IPR020428 GO:0016791
Bhi02g01339 200 PRINTS Plant and fungal dual specificity phosphatase signature 51 64 IPR020428 GO:0016791
Bhi02g01339 200 PRINTS Plant and fungal dual specificity phosphatase signature 70 84 IPR020428 GO:0016791
Bhi02g01339 200 PRINTS Plant and fungal dual specificity phosphatase signature 87 101 IPR020428 GO:0016791
Bhi02g01339 200 SUPERFAMILY (Phosphotyrosine protein) phosphatases II 15 160 IPR029021 -
Bhi02g01339 200 ProSiteProfiles Dual specificity protein phosphatase domain profile. 19 170 IPR020422 GO:0006470|GO:0008138
Bhi02g01339 200 ProSitePatterns Tyrosine specific protein phosphatases active site. 109 119 IPR016130 GO:0016311|GO:0016791
Bhi02g01339 200 PANTHER TYROSINE-PROTEIN PHOSPHATASE 10 183 - -
Bhi02g01339 200 Gene3D Protein tyrosine phosphatase superfamily 13 163 IPR029021 -
Bhi02g01339 200 Pfam Tyrosine phosphatase family 14 163 IPR004861 -
Bhi02g01339 200 PANTHER TYROSINE-PROTEIN PHOSPHATASE DSP5 10 183 - -
Bhi02g01339 200 CDD PFA-DSP_Siw14 14 160 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bhi02g01339 K18045 SIW14, OCA3; tyrosine-protein phosphatase SIW14 [EC:3.1.3.48] - csv:101211082 374.785
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bhi02g01339 Bhi-Chr2:33532619 Bhi05g02097 Bhi-Chr5:63867596 5.89E-77 dispersed
Bhi02g01339 Bhi-Chr2:33532619 Bhi10g01060 Bhi-Chr10:21444321 1.73E-82 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bhi03g00963 . 33 600 Protein tyrosine phosphatase (PTP) family AT3G50110 61.8 8.9e-191 664.5
Bhi05g01088 . 43 614 Protein tyrosine phosphatase (PTP) family AT3G50110 58.4 2.4e-180 629.8
Bhi11g02950 . 1 407 Protein tyrosine phosphatase (PTP) family AT5G39400 65.9 2.9e-158 555.8
Bhi11g02948 . 1 407 Protein tyrosine phosphatase (PTP) family AT5G39400 65.9 2.9e-158 555.8
Bhi11g02949 . 1 407 Protein tyrosine phosphatase (PTP) family AT5G39400 65.9 2.9e-158 555.8
Bhi04g01281 . 1 857 Protein tyrosine phosphatase (PTP) family AT3G10550 69.0 0.0e+00 1184.9
Bhi04g01282 . 1 720 Protein tyrosine phosphatase (PTP) family AT3G10550 69.8 5.9e-299 1024.2
Bhi04g01281 . 1 857 Protein tyrosine phosphatase (PTP) family AT5G04540 65.5 0.0e+00 1120.1
Bhi04g01282 . 1 720 Protein tyrosine phosphatase (PTP) family AT5G04540 68.0 3.6e-288 988.4
Bhi02g00881 . 1 1281 Protein tyrosine phosphatase (PTP) family AT5G58160 53.6 2.8e-313 1072.4
Bhi09g01578 . 82 389 Protein tyrosine phosphatase (PTP) family AT1G71860 67.1 8.1e-122 434.5
Bhi09g01577 . 82 389 Protein tyrosine phosphatase (PTP) family AT1G71860 67.1 8.1e-122 434.5
Bhi02g00621 . 7 913 Protein tyrosine phosphatase (PTP) family AT5G23720 64.9 0.0e+00 1097.0
Bhi12g01807 . 33 170 Protein tyrosine phosphatase (PTP) family AT3G06110 56.5 1.6e-41 166.8
Bhi12g01805 . 33 170 Protein tyrosine phosphatase (PTP) family AT3G06110 56.5 1.6e-41 166.8
Bhi12g01806 . 33 170 Protein tyrosine phosphatase (PTP) family AT3G06110 56.5 1.6e-41 166.8
Bhi05g02087 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 77.5 3.4e-71 265.4
Bhi05g02088 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 77.5 3.4e-71 265.4
Bhi07g00747 . 96 376 Protein tyrosine phosphatase (PTP) family AT3G52180 69.4 2.3e-114 409.5
Bhi07g00476 . 99 325 Protein tyrosine phosphatase (PTP) family AT3G10940 78.1 1.9e-108 389.8
Bhi11g01647 . 141 589 Protein tyrosine phosphatase (PTP) family AT3G01510 72.8 3.8e-204 708.4
Bhi11g01648 . 2 450 Protein tyrosine phosphatase (PTP) family AT3G01510 72.8 3.8e-204 708.4
Bhi11g01646 . 141 550 Protein tyrosine phosphatase (PTP) family AT3G01510 71.7 8.9e-185 644.0
Bhi10g01060 CCT 9 212 Protein tyrosine phosphatase (PTP) family AT2G32960 59.8 1.5e-75 280.4
Bhi05g02096 . 28 236 Protein tyrosine phosphatase (PTP) family AT2G32960 62.6 1.7e-71 266.9
Bhi05g02097 CCT 28 206 Protein tyrosine phosphatase (PTP) family AT2G32960 62.1 3.2e-70 262.7
Bhi02g01339 . 3 170 Protein tyrosine phosphatase (PTP) family AT2G32960 52.0 5.0e-55 212.2
Bhi11g00051 . 1 333 Protein tyrosine phosphatase (PTP) family AT2G35680 55.8 1.6e-101 367.1
Bhi06g01678 . 106 357 Protein tyrosine phosphatase (PTP) family AT2G35680 54.7 1.2e-80 297.7
Bhi06g01678 . 121 312 Protein tyrosine phosphatase (PTP) family AT5G56610 50.5 2.0e-45 179.9
Bhi10g01060 CCT 18 212 Protein tyrosine phosphatase (PTP) family AT4G03960 71.8 2.5e-78 289.3
Bhi05g02097 CCT 27 206 Protein tyrosine phosphatase (PTP) family AT4G03960 71.7 5.3e-73 271.6
Bhi05g02096 . 27 236 Protein tyrosine phosphatase (PTP) family AT4G03960 61.4 3.0e-68 255.8
Bhi02g01339 . 13 170 Protein tyrosine phosphatase (PTP) family AT4G03960 62.0 6.3e-58 221.5
Bhi02g01339 . 7 196 Protein tyrosine phosphatase (PTP) family AT3G02800 70.5 1.7e-79 293.1
Bhi10g01060 CCT 40 206 Protein tyrosine phosphatase (PTP) family AT3G02800 61.7 2.1e-56 216.5
Bhi05g02097 CCT 35 201 Protein tyrosine phosphatase (PTP) family AT3G02800 56.9 1.5e-54 210.3
Bhi07g00941 . 1 188 Protein tyrosine phosphatase (PTP) family AT3G55270 64.1 9.1e-60 229.6
Bhi07g00939 . 1 188 Protein tyrosine phosphatase (PTP) family AT3G55270 64.1 9.1e-60 229.6
Bhi07g00938 . 1 188 Protein tyrosine phosphatase (PTP) family AT3G55270 64.1 9.1e-60 229.6
Bhi07g00937 . 1 188 Protein tyrosine phosphatase (PTP) family AT3G55270 64.1 9.1e-60 229.6
Bhi07g00940 . 1 188 Protein tyrosine phosphatase (PTP) family AT3G55270 64.1 9.1e-60 229.6
Bhi11g02950 . 1 407 Protein tyrosine phosphatase (PTP) family AT5G39400 65.9 2.9e-158 555.8
Bhi11g02948 . 1 407 Protein tyrosine phosphatase (PTP) family AT5G39400 65.9 2.9e-158 555.8
Bhi11g02949 . 1 407 Protein tyrosine phosphatase (PTP) family AT5G39400 65.9 2.9e-158 555.8
Bhi05g01088 . 33 614 Protein tyrosine phosphatase (PTP) family AT3G19420 66.1 6.8e-220 761.1
Bhi03g00963 . 33 600 Protein tyrosine phosphatase (PTP) family AT3G19420 62.2 6.6e-199 691.4
Bhi03g00963 . 33 600 Protein tyrosine phosphatase (PTP) family AT3G50110 61.8 8.9e-191 664.5
Bhi05g01088 . 43 614 Protein tyrosine phosphatase (PTP) family AT3G50110 58.4 2.4e-180 629.8
Bhi02g00881 . 1 1281 Protein tyrosine phosphatase (PTP) family AT5G58160 53.6 2.8e-313 1072.4
Bhi04g01281 . 1 857 Protein tyrosine phosphatase (PTP) family AT3G10550 69.0 0.0e+00 1184.9
Bhi04g01282 . 1 720 Protein tyrosine phosphatase (PTP) family AT3G10550 69.8 5.9e-299 1024.2
Bhi04g01281 . 1 857 Protein tyrosine phosphatase (PTP) family AT5G04540 65.5 0.0e+00 1120.1
Bhi04g01282 . 1 720 Protein tyrosine phosphatase (PTP) family AT5G04540 68.0 3.6e-288 988.4
Bhi10g00068 . 17 244 Protein tyrosine phosphatase (PTP) family AT3G44620 56.8 2.1e-69 260.0
Bhi11g00140 . 22 318 Protein tyrosine phosphatase (PTP) family AT2G35320 63.3 3.4e-111 399.1
Bhi11g00141 . 22 318 Protein tyrosine phosphatase (PTP) family AT2G35320 63.3 3.4e-111 399.1
Bhi03g02108 . 1 672 Protein tyrosine phosphatase (PTP) family AT3G09100 70.4 2.3e-285 978.8
Bhi03g02108 . 5 672 Protein tyrosine phosphatase (PTP) family AT5G01290 65.8 1.0e-258 890.2
Bhi03g02108 . 86 672 Protein tyrosine phosphatase (PTP) family AT5G28210 56.9 8.6e-186 647.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0008556 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 35
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bhi02g01339 Bhi_Chr02 FPKM 0.405213 0.47416 1.114402 1.446311 1.237209 1.362185 1.191344 2.273237 2.086583 2.206288