Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bhi03g01314 TATTTAAAATAATTTCTCTAATTAAATTCAATTAATTAACTAAATTAATTTCAAATTAAATTTAACCATGGCGATGTCGTCGACGTTTTATCTATCTGCCGCCTGCACGTCCAACGTAACTGCCCGATCGATCATGGAGGAGTAACTGTCTTCCATGGATCAACGGCTACTTCTTCAATTTAATCAAATTTCAAATTCCCAATTCCATTTTTAAACCCACAAACCTCTCGATTTTTTTTAAAAAAATTCTACATTCAAATTTCTCCCTCTGCTCAAAACTCTGCCGGAGATCAAATTTCTTCTGAATTTCTGAACCAACCAATTCAAGAACAGACCCAAATCGGCGAAGATGAACGATTTGATGACGAAATCGTTCTTAAGTTATGTGGAATTGAAGAAACAGGCGCAGAGGGACGCCGCCGGCGACGGCTTCGACATTGAATCTGGCGGCCAAGAACTCAATCCGATGGAAGAACAGAACCTGTCTCTGTTTTTCGAACAAGTCGATGAAATCAAGACCCAAATGGAAGAGACAACCAATCTCTTAGTTGACATTCAAAAACTAAATCAAGAAGCGAAATCAACCCACAACGCCAAAATTCTCCGTGGATTAAGAGACAGAATCGACTCCGATATGGTCTCAATCCTCCGCAGAGCAAGAATCCTCAAAGAAAAATTGGCCTCTCTCGACCAATCCAACACCGCCAACCGCCTGATGTCCGTCGCGTACGGCGAAGGAACCGCGGTGGACCGGACAAGAACTTCAATCACGAAGGGACTGAGAGTGAAATTGAGAGAAATGATGAACGAATTTCAGGGGTTGAGAGAAAAAGTTGTGGCAGATCACAAGGAGGATCTAAGAAGAAGGTATTTTGGTGCAAATGGGGAACAACCCAGTGAAGAACAAGTGGAGAAGATTATGTCTGGGAGTTTGAAATTGGAAACGTTTGAAGGGACATTGAGGGAGACTGAGTTAGGGGACCGAGTCAGGCACGAGTCAGTGATGGATATTCAGAGAAGTTTGAATAAGCTTCATCAGGTGTTTTTGGACATGGCGATTTTGGTTGAGAGTGAAGGGGAGAAGATGGAGGACATAGAGGAGAATGTAGCGAAAGCTGGGAAGTTCATCAATGGCGGAACTCGAAGCCTTTACTATGCGAACCAGATGAAGAGGAAGAACAAGAAATGGGTGTATTGGGTTTGGGCTATCATTTTTCTTATATTGCTTGTTTGCATTGTTTCAATGTTGGTTTGTTGAATTTTTCTATTTTTTTTATTTTTTTAGCTTTCCTCAACTCATAAATTGAGAATTTTGTAATGGAAACCTTTTCTTTTTCTTCTTGTCCATTCCTATGTATCATTCCTATCTTTACCTGGAATTCAACTTTTTGTTGAG 1396 40.62 MNDLMTKSFLSYVELKKQAQRDAAGDGFDIESGGQELNPMEEQNLSLFFEQVDEIKTQMEETTNLLVDIQKLNQEAKSTHNAKILRGLRDRIDSDMVSILRRARILKEKLASLDQSNTANRLMSVAYGEGTAVDRTRTSITKGLRVKLREMMNEFQGLREKVVADHKEDLRRRYFGANGEQPSEEQVEKIMSGSLKLETFEGTLRETELGDRVRHESVMDIQRSLNKLHQVFLDMAILVESEGEKMEDIEENVAKAGKFINGGTRSLYYANQMKRKNKKWVYWVWAIIFLILLVCIVSMLVC 302
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
3 27049194 27050658 - XM_039027476.1 Bhi03g01314 30091

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bhi03g01314 302 CDD SynN 48 195 IPR006011 GO:0016020
Bhi03g01314 302 PANTHER SYNTAXIN-112 3 298 - -
Bhi03g01314 302 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 214 270 IPR000727 -
Bhi03g01314 302 Gene3D - 41 172 - -
Bhi03g01314 302 SUPERFAMILY t-snare proteins 44 263 IPR010989 GO:0016020|GO:0016192
Bhi03g01314 302 Coils Coil 52 72 - -
Bhi03g01314 302 PANTHER SYNTAXIN 3 298 IPR045242 -
Bhi03g01314 302 SMART tSNARE_6 203 270 IPR000727 -
Bhi03g01314 302 Gene3D - 202 301 - -
Bhi03g01314 302 SMART SynN_4 40 167 IPR006011 GO:0016020
Bhi03g01314 302 CDD SNARE_syntaxin1-like 214 267 - -
Bhi03g01314 302 Pfam Syntaxin 48 243 IPR006011 GO:0016020
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bhi03g01314 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101217836 536.954
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bhi03g01314 Bhi-Chr3:27049194 Bhi03g02299 Bhi-Chr3:50565201 7.32E-74 dispersed
Bhi03g01314 Bhi-Chr3:27049194 Bhi03g01315 Bhi-Chr3:27049194 0 tandem
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bhi04g01047 . 8 338 SNARE and Associated Proteins AT3G24350 63.9 7.1e-100 361.7
Bhi03g02299 CCT 1 309 SNARE and Associated Proteins AT1G08560 67.8 1.6e-100 363.6
Bhi03g01314 . 1 300 SNARE and Associated Proteins AT2G18260 56.4 5.8e-87 318.5
Bhi03g01315 . 1 300 SNARE and Associated Proteins AT2G18260 56.4 5.8e-87 318.5
Bhi11g02367 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 8.9e-115 411.0
Bhi03g01775 . 24 283 SNARE and Associated Proteins AT3G11820 72.3 3.5e-103 372.5
Bhi03g01774 . 24 283 SNARE and Associated Proteins AT3G11820 72.3 3.5e-103 372.5
Bhi08g01910 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 4.8e-92 335.5
Bhi11g01551 CCT 31 285 SNARE and Associated Proteins AT3G11820 52.9 4.8e-68 255.8
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 2.0e-91 333.6
Bhi03g01775 . 1 283 SNARE and Associated Proteins AT3G52400 60.8 5.5e-86 315.5
Bhi03g01774 . 1 283 SNARE and Associated Proteins AT3G52400 60.8 5.5e-86 315.5
Bhi08g01910 . 1 281 SNARE and Associated Proteins AT3G52400 56.7 1.8e-81 300.4
Bhi08g01910 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 1.6e-108 390.2
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.1e-82 304.3
Bhi03g01775 . 1 290 SNARE and Associated Proteins AT4G03330 53.8 4.9e-78 288.9
Bhi03g01774 . 1 290 SNARE and Associated Proteins AT4G03330 53.8 4.9e-78 288.9
Bhi11g01551 CCT 1 285 SNARE and Associated Proteins AT4G03330 51.6 1.4e-69 260.8
Bhi08g01910 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 4.0e-128 455.3
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT1G61290 62.8 3.3e-90 329.3
Bhi03g01775 . 1 283 SNARE and Associated Proteins AT1G61290 56.9 9.6e-82 301.2
Bhi03g01774 . 1 283 SNARE and Associated Proteins AT1G61290 56.9 9.6e-82 301.2
Bhi08g01910 . 1 303 SNARE and Associated Proteins AT1G11250 77.2 1.2e-124 443.7
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 1.2e-92 337.4
Bhi03g01775 . 1 292 SNARE and Associated Proteins AT1G11250 56.8 8.2e-86 314.7
Bhi03g01774 . 1 292 SNARE and Associated Proteins AT1G11250 56.8 8.2e-86 314.7
Bhi11g01551 CCT 1 308 SNARE and Associated Proteins AT3G03800 73.1 1.6e-113 406.8
Bhi10g01452 . 1 305 SNARE and Associated Proteins AT3G03800 54.8 1.3e-83 307.4
Bhi10g01451 . 1 270 SNARE and Associated Proteins AT3G03800 57.8 7.4e-82 301.6
Bhi11g01551 CCT 1 203 SNARE and Associated Proteins AT5G08080 77.9 3.6e-78 288.9
Bhi10g01452 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 2.1e-54 209.9
Bhi10g01451 . 2 169 SNARE and Associated Proteins AT5G08080 62.5 2.4e-50 196.4
Bhi11g00014 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 4.7e-75 278.9
Bhi11g00014 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 4.6e-80 295.4
Bhi11g00014 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 3.1e-73 272.7
Bhi11g00014 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 5.2e-52 202.6
Bhi07g00570 . 1 336 SNARE and Associated Proteins AT5G05760 65.3 3.2e-110 396.0
Bhi04g01047 . 8 338 SNARE and Associated Proteins AT3G24350 63.9 7.1e-100 361.7
Bhi06g01461 . 1 327 SNARE and Associated Proteins AT5G26980 75.2 5.7e-125 444.9
Bhi09g00937 . 1 318 SNARE and Associated Proteins AT5G26980 66.5 8.0e-103 371.3
Bhi09g00938 . 1 317 SNARE and Associated Proteins AT5G26980 66.5 2.0e-101 366.7
Bhi09g00937 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 5.9e-106 381.7
Bhi09g00938 . 1 317 SNARE and Associated Proteins AT4G02195 66.8 3.3e-104 375.9
Bhi06g01461 . 1 329 SNARE and Associated Proteins AT4G02195 63.4 2.1e-103 373.2
Bhi06g01461 . 1 328 SNARE and Associated Proteins AT3G05710 74.8 6.2e-127 451.4
Bhi09g00937 . 1 318 SNARE and Associated Proteins AT3G05710 64.0 2.5e-99 359.8
Bhi09g00938 . 1 317 SNARE and Associated Proteins AT3G05710 64.0 6.1e-98 355.1
Bhi09g01700 . 1 233 SNARE and Associated Proteins AT1G16240 70.8 1.8e-88 323.2
Bhi11g00534 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi11g00535 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi11g00536 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi11g00537 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi09g01700 . 1 233 SNARE and Associated Proteins AT1G79590 69.5 3.3e-86 315.8
Bhi11g00534 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi11g00535 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi11g00536 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi11g00537 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi12g02591 . 56 246 SNARE and Associated Proteins AT1G28490 71.7 1.7e-66 250.0
Bhi11g02112 . 1 264 SNARE and Associated Proteins AT3G09740 79.3 1.6e-112 403.3
Bhi10g00561 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 1.3e-95 347.1
Bhi10g00561 . 1 265 SNARE and Associated Proteins AT3G45280 64.4 8.4e-90 327.8
Bhi11g02112 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 3.5e-88 322.4
Bhi11g02112 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 1.1e-94 344.0
Bhi10g00561 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 5.2e-84 308.5
Bhi04g02346 . 99 342 SNARE and Associated Proteins AT1G51740 72.4 7.0e-91 331.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002433 5 3 5 4 2 1 2 1 2 2 1 1 2 1 2 1 1 3 2 1 2 3 2 2 1 1 1 2 1 4 61
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bhi03g01314 Bhi_Chr03 FPKM 135.701019 145.434204 9.315817 9.834249 4.77002 4.637772 4.134314 58.28688 52.308556 53.955044