Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Bhi08g01147	CGACAAACAAATGAACATCATAATCTTAAATGCCATTACAATGCCATGCCCAAAATACACTTCTTGAACTCAAACCAAAACCAGGTTTTCTTCTACCACCATTCTTGCTGAAAAAATGGCAACTGTCATGACCCAGGCTTCGGCCTCTGTCTTCCGGCCATGCACTTTGAGATCGAGGTTTCTTTCGCGGACTTCGGGAAAGTTTAACAGAGGTTTGTCTGTTAAGCCAACAACTTCTTCAGTTCCTAATTCTTTCAAAGTTGAGGCCAAGAAAGGAGAGTGGTTGCCAGGTTTGCCATCGCCAGCTTACCTTGATGGAAGTCTGCCAGGTGACAATGGTTTTGATCCTCTGGGACTTGCAGAGGATCCTGAAAACTTGAGGTGGTATGTGCAAGCCGAGCTCGTGAATGGCCGATGGGCGATGCTCGGAGTTGCAGGTATGCTATTGCCTGAAGTCTTCACAAGTTTCGGAATCATCAACGTACCGAAATGGTACGATGCAGGGAAAGCTGAGTATTTCGCATCATCATCGACTCTCTTTGTGATTGAGTTCATTCTGTTCCATTATGTGGAAATCAGAAGATGGCAAGATATAAAGAACCCGGGAAGTGTAAACCAAGATCCAATTTTCAAGCAATACAGCTTGCCACCAAATGATGTTGGATACCCAGGGGGAATTTTCAACCCACTCAACTTTGAACCAACTCTCGAGGCCAAGGAAAAGGAGATTGCTAATGGTAGACTGGCAATGTTGGCATTCTTGGGATTCATTGTTCAACACAATGTGACTGGAAAAGGTCCATTTGACAACTTCTTGCAGCACATTTCAGACCCATGGCACAACACTATAGTTCAAACACTAAGGGGATAGGACAATAAAATATGTGCAATATTGTGTGATCTGTGTGATTGTAGACATGGGAACTATCATTGTACAGGATGGTAGCAGTTATATAAATGTAGTATAAAAGTATGCAACTTGGTTTAACTGAGAAAGAAAGATTGTAATCATGCCGACTTCTTTAATTTTCTCGAAATATGATATAAGAAGTATGAAA	1058	42.06	MATVMTQASASVFRPCTLRSRFLSRTSGKFNRGLSVKPTTSSVPNSFKVEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTSFGIINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNDVGYPGGIFNPLNFEPTLEAKEKEIANGRLAMLAFLGFIVQHNVTGKGPFDNFLQHISDPWHNTIVQTLRG	251

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
8	36268098	36269329	+	XM_039038897.1	Bhi08g01147	41480

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Bhi08g01147	251	Gene3D	Chlorophyll a/b binding protein domain	63	242	-	-
Bhi08g01147	251	PANTHER	CHLOROPHYLL A-B BINDING PROTEIN, CHLOROPLASTIC	1	251	-	-
Bhi08g01147	251	PANTHER	CHLOROPHYLL A/B BINDING PROTEIN	1	251	IPR001344	GO:0009765\|GO:0016020
Bhi08g01147	251	Pfam	Chlorophyll A-B binding protein	63	222	IPR022796	-
Bhi08g01147	251	SUPERFAMILY	Chlorophyll a-b binding protein	53	249	-	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Bhi08g01147	K08910	LHCA4; light-harvesting complex I chlorophyll a/b binding protein 4	-	csv:101218675	492.271

Dupl-types

Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
Bhi08g01147	Bhi-Chr8:36268098	Bhi09g02763	Bhi-Chr9:73657545	3.12E-36	dispersed
Bhi02g01410	Bhi-Chr2:37514023	Bhi08g01147	Bhi-Chr8:36268098	9.52E-50	transposed
Bhi02g01759	Bhi-Chr2:48590094	Bhi08g01147	Bhi-Chr8:36268098	2.38E-49	transposed
Bhi03g02124	Bhi-Chr3:45980618	Bhi08g01147	Bhi-Chr8:36268098	3.11E-32	transposed
Bhi04g00351	Bhi-Chr4:8383398	Bhi08g01147	Bhi-Chr8:36268098	1.44E-66	transposed
Bhi04g01789	Bhi-Chr4:43338563	Bhi08g01147	Bhi-Chr8:36268098	5.19E-28	transposed
Bhi06g00641	Bhi-Chr6:14959364	Bhi08g01147	Bhi-Chr8:36268098	7.00E-48	transposed
Bhi07g01927	Bhi-Chr7:51621075	Bhi08g01147	Bhi-Chr8:36268098	4.27E-77	transposed
Bhi11g01849	Bhi-Chr11:52691166	Bhi08g01147	Bhi-Chr8:36268098	9.01E-31	transposed
Bhi02g00306	Bhi-Chr2:5798916	Bhi08g01147	Bhi-Chr8:36268098	1.01E-168	wgd

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi17g566	Blo04g00773	.	Bda06g00542	Bda15g00608	Bpe12g00541	.	.	Bma12g00994	.	.	.	Cma11g00139	Car10g00187	Car11g00156	.	.	Cpe04g01495	.	.	.	.	.	.	.	Cla06g01586	Cam06g1755	Cec06g1811	Cco06g1814	Clacu06g1721	Cmu06g1664	Cre06g2478	Cone2ag0840	Cone16ag0175	.	.	Lsi02g00081	Csa01g00560	Chy12g01533	Cme12g01983	Blo13g00003	Blo15g00312	.	.	Bpe07g00779	.	.	Bma08g00227	Sed08g2078	Cmo10g00213	Cmo11g00172	.	.	.	.	.	Cpe18g00788	Bhi08g01147	Tan05g2431	Cmetu02g0368	Lac10g0087	Hepe07g2501	.	.	Cla04g01190	Cam04g1247	Cec01g1758	Cco01g1804	Clacu04g1276	Cmu04g1254	Cre01g1547	.	Csa01g00241	Chy02g02491	Cme02g01877

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Bhi08g00625	.	1	399	Chloroplast and Mitochondria Gene Families	AT2G28800	64.4	2.3e-137	486.5
Bhi04g00600	.	71	423	Chloroplast and Mitochondria Gene Families	AT2G28800	55.3	2.5e-99	360.1
Bhi04g01789	.	3	255	Chloroplast and Mitochondria Gene Families	AT1G15820	82.0	2.2e-119	426.0
Bhi05g01456	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	89.1	1.9e-143	506.1
Bhi10g00982	.	2	267	Chloroplast and Mitochondria Gene Families	AT3G27690	78.0	2.3e-120	429.5
Bhi03g00049	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.0	8.7e-120	427.6
Bhi03g00050	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.4	1.1e-119	427.2
Bhi11g01312	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.6	5.6e-119	424.9
Bhi11g00737	.	1	162	Chloroplast and Mitochondria Gene Families	AT3G27690	73.6	2.8e-62	236.5
Bhi09g02763	.	123	339	Chloroplast and Mitochondria Gene Families	AT3G27690	51.2	9.2e-53	204.9
Bhi06g00098	.	73	276	Chloroplast and Mitochondria Gene Families	AT3G27690	52.6	1.7e-51	200.7
Bhi07g01927	.	36	273	Chloroplast and Mitochondria Gene Families	AT3G61470	85.8	5.4e-126	448.0
Bhi02g00306	.	22	249	Chloroplast and Mitochondria Gene Families	AT3G61470	51.3	7.6e-64	241.5
Bhi02g01759	.	56	217	Chloroplast and Mitochondria Gene Families	AT3G61470	52.4	2.7e-61	233.0
Bhi08g01147	.	56	245	Chloroplast and Mitochondria Gene Families	AT3G61470	55.6	4.6e-61	232.3
Bhi06g00641	.	1	198	Chloroplast and Mitochondria Gene Families	AT3G54890	81.6	8.8e-90	327.4
Bhi03g02124	.	3	284	Chloroplast and Mitochondria Gene Families	AT3G08940	83.0	7.1e-135	477.6
Bhi11g01849	.	2	278	Chloroplast and Mitochondria Gene Families	AT3G08940	84.5	3.9e-133	471.9
Bhi09g02763	.	15	346	Chloroplast and Mitochondria Gene Families	AT1G76570	72.7	3.6e-143	505.4
Bhi09g02762	.	15	297	Chloroplast and Mitochondria Gene Families	AT1G76570	61.3	2.9e-108	389.4
Bhi02g01410	.	1	273	Chloroplast and Mitochondria Gene Families	AT1G61520	86.4	4.6e-136	481.5
Bhi05g01456	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G05070	89.1	2.9e-143	505.4
Bhi03g00049	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.9	4.5e-120	428.3
Bhi03g00050	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	5.9e-120	427.9
Bhi10g00982	.	7	267	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	2.3e-119	426.0
Bhi11g01312	.	27	265	Chloroplast and Mitochondria Gene Families	AT2G05070	84.5	1.9e-118	422.9
Bhi11g00737	.	1	162	Chloroplast and Mitochondria Gene Families	AT2G05070	74.2	2.5e-62	236.5
Bhi06g00098	.	73	276	Chloroplast and Mitochondria Gene Families	AT2G05070	53.1	1.2e-51	201.1
Bhi09g02763	.	123	339	Chloroplast and Mitochondria Gene Families	AT2G05070	50.2	2.6e-51	199.9
Bhi05g01456	.	1	237	Chloroplast and Mitochondria Gene Families	AT2G05100	89.0	1.6e-124	443.4
Bhi03g00049	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	76.5	2.5e-101	366.3
Bhi03g00050	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.9	4.3e-101	365.5
Bhi10g00982	.	7	239	Chloroplast and Mitochondria Gene Families	AT2G05100	77.0	1.6e-100	363.6
Bhi11g01312	.	8	237	Chloroplast and Mitochondria Gene Families	AT2G05100	78.4	1.6e-100	363.6
Bhi11g00737	.	1	134	Chloroplast and Mitochondria Gene Families	AT2G05100	73.3	1.4e-46	184.5
Bhi06g00098	.	73	260	Chloroplast and Mitochondria Gene Families	AT2G05100	51.8	4.1e-43	172.9
Bhi03g02124	.	3	167	Chloroplast and Mitochondria Gene Families	AT2G40100	73.4	3.1e-67	252.3
Bhi11g01849	.	2	164	Chloroplast and Mitochondria Gene Families	AT2G40100	69.6	3.0e-62	235.7
Bhi10g00982	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29930	88.4	2.0e-136	482.6
Bhi03g00050	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.0	2.3e-135	479.2
Bhi03g00049	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.0	5.0e-135	478.0
Bhi11g01312	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29930	84.9	8.6e-127	450.7
Bhi05g01456	.	30	265	Chloroplast and Mitochondria Gene Families	AT1G29930	82.9	1.5e-115	413.3
Bhi11g00737	.	1	162	Chloroplast and Mitochondria Gene Families	AT1G29930	71.8	9.7e-62	234.6
Bhi10g00982	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29920	88.1	7.8e-136	480.7
Bhi03g00050	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.6	8.6e-135	477.2
Bhi03g00049	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.6	1.9e-134	476.1
Bhi11g01312	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29920	84.9	1.1e-126	450.3
Bhi05g01456	.	30	265	Chloroplast and Mitochondria Gene Families	AT1G29920	82.9	1.5e-115	413.3
Bhi11g00737	.	1	162	Chloroplast and Mitochondria Gene Families	AT1G29920	71.8	9.7e-62	234.6
Bhi06g00098	.	56	276	Chloroplast and Mitochondria Gene Families	AT1G29920	50.7	1.1e-52	204.5
Bhi10g00982	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29910	88.1	7.8e-136	480.7
Bhi03g00050	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.6	8.6e-135	477.2
Bhi03g00049	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.6	1.9e-134	476.1
Bhi11g01312	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29910	84.9	1.1e-126	450.3
Bhi05g01456	.	30	265	Chloroplast and Mitochondria Gene Families	AT1G29910	82.9	1.5e-115	413.3
Bhi11g00737	.	1	162	Chloroplast and Mitochondria Gene Families	AT1G29910	71.8	9.7e-62	234.6
Bhi06g00098	.	56	276	Chloroplast and Mitochondria Gene Families	AT1G29910	50.7	1.1e-52	204.5
Bhi06g00098	.	11	291	Chloroplast and Mitochondria Gene Families	AT4G10340	85.1	2.7e-139	492.3
Bhi03g00049	.	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	7.5e-57	218.4
Bhi03g00050	.	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	7.5e-57	218.4
Bhi11g01312	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	1.7e-56	217.2
Bhi10g00982	.	51	255	Chloroplast and Mitochondria Gene Families	AT4G10340	53.6	3.7e-56	216.1
Bhi05g01456	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.6	4.6e-54	209.1
Bhi10g00982	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34420	88.4	1.3e-135	479.9
Bhi03g00050	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	87.3	9.4e-134	473.8
Bhi03g00049	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	87.3	2.1e-133	472.6
Bhi11g01312	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34420	85.3	1.7e-127	453.0
Bhi05g01456	.	3	265	Chloroplast and Mitochondria Gene Families	AT2G34420	76.4	6.8e-116	414.5
Bhi11g00737	.	1	162	Chloroplast and Mitochondria Gene Families	AT2G34420	72.4	9.6e-62	234.6
Bhi03g00050	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	88.7	7.0e-137	484.2
Bhi03g00049	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	88.0	2.7e-136	482.3
Bhi10g00982	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34430	88.1	2.2e-135	479.2
Bhi11g01312	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34430	85.6	2.4e-129	459.1
Bhi05g01456	.	31	265	Chloroplast and Mitochondria Gene Families	AT2G34430	82.8	6.4e-114	407.9
Bhi11g00737	.	1	162	Chloroplast and Mitochondria Gene Families	AT2G34430	72.4	9.6e-62	234.6
Bhi11g01849	.	2	278	Chloroplast and Mitochondria Gene Families	AT5G01530	86.7	4.8e-139	491.5
Bhi03g02124	.	2	284	Chloroplast and Mitochondria Gene Families	AT5G01530	84.2	8.1e-139	490.7
Bhi11g00879	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	92.7	8.3e-143	503.8
Bhi11g00878	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	92.7	8.3e-143	503.8
Bhi11g00880	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	92.7	8.3e-143	503.8
Bhi11g00879	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	84.7	1.6e-148	523.1
Bhi11g00878	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	84.7	1.6e-148	523.1
Bhi11g00880	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	84.7	1.6e-148	523.1
Bhi10g00847	.	5	329	Chloroplast and Mitochondria Gene Families	AT2G30160	75.2	5.6e-144	508.1
Bhi03g02177	.	9	311	Chloroplast and Mitochondria Gene Families	AT2G30160	64.8	7.4e-112	401.4
Bhi10g00847	.	5	323	Chloroplast and Mitochondria Gene Families	AT1G07030	76.1	3.0e-142	502.3
Bhi03g02177	.	5	311	Chloroplast and Mitochondria Gene Families	AT1G07030	67.8	8.0e-119	424.5
Bhi09g00933	.	1	305	Chloroplast and Mitochondria Gene Families	AT2G47490	76.7	1.4e-136	483.4
Bhi12g00835	.	9	312	Chloroplast and Mitochondria Gene Families	AT2G47490	64.5	9.1e-112	401.0
Bhi12g00835	.	10	364	Chloroplast and Mitochondria Gene Families	AT1G25380	64.3	1.7e-122	436.8
Bhi09g00933	.	11	297	Chloroplast and Mitochondria Gene Families	AT1G25380	64.5	1.3e-106	384.0
Bhi08g01904	.	5	584	Chloroplast and Mitochondria Gene Families	AT4G21490	74.9	2.9e-260	895.2
Bhi10g01180	CCT	1	585	Chloroplast and Mitochondria Gene Families	AT4G21490	68.9	4.3e-240	828.2
Bhi05g01823	CCT	1	574	Chloroplast and Mitochondria Gene Families	AT4G21490	64.0	1.8e-222	769.6
Bhi09g00363	.	5	186	Chloroplast and Mitochondria Gene Families	AT1G17530	65.4	1.7e-62	236.5
Bhi02g01229	.	4	179	Chloroplast and Mitochondria Gene Families	AT1G17530	57.9	1.2e-50	197.2
Bhi02g01229	.	12	183	Chloroplast and Mitochondria Gene Families	AT3G04800	58.4	9.2e-51	197.6
Bhi09g00363	.	22	190	Chloroplast and Mitochondria Gene Families	AT3G04800	55.6	8.4e-44	174.5
Bhi09g00363	.	15	190	Chloroplast and Mitochondria Gene Families	AT1G72750	69.6	8.6e-65	244.2
Bhi02g01229	.	1	183	Chloroplast and Mitochondria Gene Families	AT1G72750	57.4	9.9e-53	204.1
Bhi07g01380	.	1	223	Chloroplast and Mitochondria Gene Families	AT1G26100	60.5	9.4e-69	257.7
Bhi06g00067	.	1	226	Chloroplast and Mitochondria Gene Families	AT5G38630	70.9	6.6e-91	331.3
Bhi05g00612	.	23	218	Chloroplast and Mitochondria Gene Families	AT4G25570	74.0	3.6e-83	305.8
Bhi12g00971	.	5	222	Chloroplast and Mitochondria Gene Families	AT1G14730	53.7	7.1e-66	248.1
Bhi12g01081	.	9	367	Chloroplast and Mitochondria Gene Families	AT5G14040	80.4	5.7e-169	591.3
Bhi02g00641	.	37	327	Chloroplast and Mitochondria Gene Families	AT5G14040	85.9	1.9e-148	523.1
Bhi05g01557	.	13	298	Chloroplast and Mitochondria Gene Families	AT5G14040	52.4	1.3e-83	307.8
Bhi01g02007	.	2	207	Chloroplast and Mitochondria Gene Families	AT5G14040	57.7	1.1e-63	241.5
Bhi12g01081	.	8	356	Chloroplast and Mitochondria Gene Families	AT3G48850	71.2	4.3e-145	511.9
Bhi02g00641	.	10	349	Chloroplast and Mitochondria Gene Families	AT3G48850	65.5	1.5e-134	476.9
Bhi05g01557	.	13	297	Chloroplast and Mitochondria Gene Families	AT3G48850	50.9	1.2e-83	307.8
Bhi01g02007	.	2	206	Chloroplast and Mitochondria Gene Families	AT3G48850	59.7	1.3e-64	244.6
Bhi05g01557	.	14	309	Chloroplast and Mitochondria Gene Families	AT2G17270	75.7	2.5e-130	462.6
Bhi12g01081	.	62	364	Chloroplast and Mitochondria Gene Families	AT2G17270	52.1	1.1e-85	314.3
Bhi06g00306	.	16	319	Chloroplast and Mitochondria Gene Families	AT5G15640	76.5	2.3e-131	466.1
Bhi01g01118	.	17	320	Chloroplast and Mitochondria Gene Families	AT5G15640	50.7	3.2e-80	296.2
Bhi01g01117	.	17	320	Chloroplast and Mitochondria Gene Families	AT5G15640	50.7	3.2e-80	296.2
Bhi01g01116	.	17	320	Chloroplast and Mitochondria Gene Families	AT5G15640	50.7	3.2e-80	296.2
Bhi09g03099	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	67.7	1.8e-124	443.4
Bhi09g03101	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	67.7	1.8e-124	443.4
Bhi09g03096	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	67.7	1.8e-124	443.4
Bhi09g03097	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	67.7	1.8e-124	443.4
Bhi09g03098	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	67.7	1.8e-124	443.4
Bhi09g03102	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	67.7	1.8e-124	443.4
Bhi09g03100	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	67.7	1.8e-124	443.4
Bhi09g00350	.	1	347	Chloroplast and Mitochondria Gene Families	AT5G26200	57.6	2.0e-104	376.7
Bhi09g00350	.	1	351	Chloroplast and Mitochondria Gene Families	AT1G72820	75.1	1.5e-147	520.0
Bhi09g03099	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	1.7e-130	463.4
Bhi09g03101	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	1.7e-130	463.4
Bhi09g03096	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	1.7e-130	463.4
Bhi09g03097	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	1.7e-130	463.4
Bhi09g03098	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	1.7e-130	463.4
Bhi09g03102	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	1.7e-130	463.4
Bhi09g03100	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	1.7e-130	463.4
Bhi12g00299	.	79	284	Chloroplast and Mitochondria Gene Families	AT5G52570	51.0	3.3e-50	196.1
Bhi12g00299	.	26	201	Chloroplast and Mitochondria Gene Families	AT4G25700	57.0	7.4e-55	211.5
Bhi12g00298	.	26	201	Chloroplast and Mitochondria Gene Families	AT4G25700	57.0	7.4e-55	211.5
Bhi11g00735	.	72	359	Chloroplast and Mitochondria Gene Families	AT5G54290	79.0	1.6e-120	430.3
Bhi11g00734	.	104	366	Chloroplast and Mitochondria Gene Families	AT5G54290	84.8	4.6e-120	428.7
Bhi02g00813	.	52	546	Chloroplast and Mitochondria Gene Families	AT2G18710	84.9	5.9e-239	824.3

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0001994	2	2	3	3	2	2	3	2	2	2	2	2	3	2	2	3	2	2	3	2	2	2	2	2	2	2	2	3	2	1	66

Transcriptome

Select	Gene	Chr	Type	da1	da2	da3	da4	da5	da6	da7	da8	da9	da10
	Bhi08g01147	Bhi_Chr08	FPKM	29.715532	29.997805	5.00499	5.305891	5.215012	4.970916	4.357342	47.462124	47.831821	43.619247