Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bhi10g00561 TTGCCTATCGAACAGCTCGTAGAAACCATAAATTTTCTAAATACGGTTAGTGGCGAACGGCGATGGTGGTCGTTGGGGGTGTTTGGTCCTGCATCTTCGTAAGCGGGTTGTACGGTGAACATCTCAGGCTGTGAGAGAGAAAGAAAGAAGGAGAAATGAAGAAGAAACAATGTTCGACCCATTTTTGTATCTCCACAAAATTTCTGCTTCAATCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCATCCCAAAATGACGGTAATCGACATCATCTTCCGAGTTGATTCCATTTGCAAGAAATATGAAAAGTATGATGTCGAGAAACAGCGTGAGCTCAATGCTTATGGTGACGATGCCTTCGCTCGCCTCTTCGCAGCCGTCGAACTCGAAATCCAAGCCGCTCTCCAGAAATCTGAGGTTGCCTTATCTGAGAAGAATAGGGCTGCTGCAGTTGCGATGAACGCTGAGGTTCGACGGAAGAAGGCTCGATTGATGGATGAAGTCCCTAAGCTTCGTAAATTGGCTCACAAGAAGGTTAAAGGGGTTCCAAAAGAAGAGCTCGAGGTCAGAGATGATCTTGTTCTTGCGCTTGAAGAGAAGATTAAAGCCATACCAGATGGGAGTACCACAGGAGCCAAACAATCTGGAGGATGGGGGCCCTCCTCCTCATCTAACAATATCAAGTTTGATTCATCAGATGGAAACTTTGAGAGCGAGTATTTCCAGCAAAATGAAGAATCAAGCCAATTTCGAAATGAGTATGAAATGCGGAAGATGAAACAGGACCAAGGTCTCGATGTCATATCTGAAGGTTTGGATATGCTGAAAAATCTTGCCCATGATATGAACGAGGAATTGGACAGGCAAGTTCCATTAATTGACGAGATCGACGCAAAGGTAGACAAGGTGACTAATGAGATGAAAAATACCAATGTTAGGCTGAAGGAAACGCTCTATGAGGTGAGAACCAGCCAAAACTTCTGCATTGATATTATTCTTCTCTGTATAATTCTTGGCATTGCTTCTTACTTGTACAATATATTGAGCTGAATTGGTTTAAGAGCTATTGTTTCATTGGTTGAATTATGGGATGATCCTGAGCTACGAGGTAAATGTGGAGGATCATTAATCAATACTCTGCACTTCGATGATCTTTTCAGCTTTGTGAAGAATTTATTCATTTCATTTCTGGGTTTACTGTAAAATATATCCAACTTTTCATTAAGCTTATTAACTTGTGTAATTGGTGGAGTTAAATATAAAGATAATGGTTTTTTGTTCTTATTTTCTGCTTTTGAGCAAATAGATTTGGAACAATATTAGTTCCCTGAAATACTTGGATCAAAGTCCGTGTAACGCTTGAT 1373 40.57 MTVIDIIFRVDSICKKYEKYDVEKQRELNAYGDDAFARLFAAVELEIQAALQKSEVALSEKNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELEVRDDLVLALEEKIKAIPDGSTTGAKQSGGWGPSSSSNNIKFDSSDGNFESEYFQQNEESSQFRNEYEMRKMKQDQGLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDAKVDKVTNEMKNTNVRLKETLYEVRTSQNFCIDIILLCIILGIASYLYNILS 265
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
10 12273471 12276617 - XM_039046240.1 Bhi10g00561 46902

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bhi10g00561 265 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 171 233 IPR000727 -
Bhi10g00561 265 SMART tSNARE_6 166 233 IPR000727 -
Bhi10g00561 265 Gene3D - 171 232 - -
Bhi10g00561 265 PANTHER SYNTAXIN 1 262 IPR045242 -
Bhi10g00561 265 ProSitePatterns Syntaxin / epimorphin family signature. 177 216 IPR006012 GO:0005484|GO:0006886|GO:0016020
Bhi10g00561 265 PANTHER SYNTAXIN-72 1 262 - -
Bhi10g00561 265 MobiDBLite consensus disorder prediction 124 145 - -
Bhi10g00561 265 Coils Coil 209 229 - -
Bhi10g00561 265 CDD SNARE_Qc 176 232 - -
Bhi10g00561 265 MobiDBLite consensus disorder prediction 122 145 - -
Bhi10g00561 265 Pfam SNARE domain 208 257 IPR000727 -
Bhi10g00561 265 SUPERFAMILY SNARE fusion complex 167 231 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bhi10g00561 K08506 SYP7; syntaxin of plants SYP7 - csv:101211289 470.314
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bhi10g00561 Bhi-Chr10:12273471 Bhi11g02112 Bhi-Chr11:59753419 9.06E-126 wgd
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bhi04g01047 . 8 338 SNARE and Associated Proteins AT3G24350 63.9 7.1e-100 361.7
Bhi03g02299 CCT 1 309 SNARE and Associated Proteins AT1G08560 67.8 1.6e-100 363.6
Bhi03g01314 . 1 300 SNARE and Associated Proteins AT2G18260 56.4 5.8e-87 318.5
Bhi03g01315 . 1 300 SNARE and Associated Proteins AT2G18260 56.4 5.8e-87 318.5
Bhi11g02367 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 8.9e-115 411.0
Bhi03g01775 . 24 283 SNARE and Associated Proteins AT3G11820 72.3 3.5e-103 372.5
Bhi03g01774 . 24 283 SNARE and Associated Proteins AT3G11820 72.3 3.5e-103 372.5
Bhi08g01910 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 4.8e-92 335.5
Bhi11g01551 CCT 31 285 SNARE and Associated Proteins AT3G11820 52.9 4.8e-68 255.8
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 2.0e-91 333.6
Bhi03g01775 . 1 283 SNARE and Associated Proteins AT3G52400 60.8 5.5e-86 315.5
Bhi03g01774 . 1 283 SNARE and Associated Proteins AT3G52400 60.8 5.5e-86 315.5
Bhi08g01910 . 1 281 SNARE and Associated Proteins AT3G52400 56.7 1.8e-81 300.4
Bhi08g01910 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 1.6e-108 390.2
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.1e-82 304.3
Bhi03g01775 . 1 290 SNARE and Associated Proteins AT4G03330 53.8 4.9e-78 288.9
Bhi03g01774 . 1 290 SNARE and Associated Proteins AT4G03330 53.8 4.9e-78 288.9
Bhi11g01551 CCT 1 285 SNARE and Associated Proteins AT4G03330 51.6 1.4e-69 260.8
Bhi08g01910 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 4.0e-128 455.3
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT1G61290 62.8 3.3e-90 329.3
Bhi03g01775 . 1 283 SNARE and Associated Proteins AT1G61290 56.9 9.6e-82 301.2
Bhi03g01774 . 1 283 SNARE and Associated Proteins AT1G61290 56.9 9.6e-82 301.2
Bhi08g01910 . 1 303 SNARE and Associated Proteins AT1G11250 77.2 1.2e-124 443.7
Bhi11g02367 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 1.2e-92 337.4
Bhi03g01775 . 1 292 SNARE and Associated Proteins AT1G11250 56.8 8.2e-86 314.7
Bhi03g01774 . 1 292 SNARE and Associated Proteins AT1G11250 56.8 8.2e-86 314.7
Bhi11g01551 CCT 1 308 SNARE and Associated Proteins AT3G03800 73.1 1.6e-113 406.8
Bhi10g01452 . 1 305 SNARE and Associated Proteins AT3G03800 54.8 1.3e-83 307.4
Bhi10g01451 . 1 270 SNARE and Associated Proteins AT3G03800 57.8 7.4e-82 301.6
Bhi11g01551 CCT 1 203 SNARE and Associated Proteins AT5G08080 77.9 3.6e-78 288.9
Bhi10g01452 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 2.1e-54 209.9
Bhi10g01451 . 2 169 SNARE and Associated Proteins AT5G08080 62.5 2.4e-50 196.4
Bhi11g00014 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 4.7e-75 278.9
Bhi11g00014 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 4.6e-80 295.4
Bhi11g00014 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 3.1e-73 272.7
Bhi11g00014 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 5.2e-52 202.6
Bhi07g00570 . 1 336 SNARE and Associated Proteins AT5G05760 65.3 3.2e-110 396.0
Bhi04g01047 . 8 338 SNARE and Associated Proteins AT3G24350 63.9 7.1e-100 361.7
Bhi06g01461 . 1 327 SNARE and Associated Proteins AT5G26980 75.2 5.7e-125 444.9
Bhi09g00937 . 1 318 SNARE and Associated Proteins AT5G26980 66.5 8.0e-103 371.3
Bhi09g00938 . 1 317 SNARE and Associated Proteins AT5G26980 66.5 2.0e-101 366.7
Bhi09g00937 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 5.9e-106 381.7
Bhi09g00938 . 1 317 SNARE and Associated Proteins AT4G02195 66.8 3.3e-104 375.9
Bhi06g01461 . 1 329 SNARE and Associated Proteins AT4G02195 63.4 2.1e-103 373.2
Bhi06g01461 . 1 328 SNARE and Associated Proteins AT3G05710 74.8 6.2e-127 451.4
Bhi09g00937 . 1 318 SNARE and Associated Proteins AT3G05710 64.0 2.5e-99 359.8
Bhi09g00938 . 1 317 SNARE and Associated Proteins AT3G05710 64.0 6.1e-98 355.1
Bhi09g01700 . 1 233 SNARE and Associated Proteins AT1G16240 70.8 1.8e-88 323.2
Bhi11g00534 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi11g00535 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi11g00536 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi11g00537 . 4 232 SNARE and Associated Proteins AT1G16240 66.8 1.8e-80 296.6
Bhi09g01700 . 1 233 SNARE and Associated Proteins AT1G79590 69.5 3.3e-86 315.8
Bhi11g00534 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi11g00535 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi11g00536 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi11g00537 . 4 232 SNARE and Associated Proteins AT1G79590 67.2 2.4e-81 299.7
Bhi12g02591 . 56 246 SNARE and Associated Proteins AT1G28490 71.7 1.7e-66 250.0
Bhi11g02112 . 1 264 SNARE and Associated Proteins AT3G09740 79.3 1.6e-112 403.3
Bhi10g00561 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 1.3e-95 347.1
Bhi10g00561 . 1 265 SNARE and Associated Proteins AT3G45280 64.4 8.4e-90 327.8
Bhi11g02112 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 3.5e-88 322.4
Bhi11g02112 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 1.1e-94 344.0
Bhi10g00561 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 5.2e-84 308.5
Bhi04g02346 . 99 342 SNARE and Associated Proteins AT1G51740 72.4 7.0e-91 331.3
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bhi10g00561 Bhi_Chr10 FPKM 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0