Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Blo03g01454 ATGCCTTCAGCTCAAGATCCATTCTACGTTGTGAAGGATGAAATCCAAGAATCTATTGATAAGGTGCAACAAACTTTTCACCGATGGGAGCGCATTTCTGATTTAGGAGAGCGATTACAGCTTACAAATGAGCTGCTTGGTAGCTGTGAAAGTATTGAGTGGCAGGTAGATGAATTAGACAAGGCTATATCTGTTGCTGCCAGAGATCCGGCTTGGTATGGAATTGATGAAGTGGAGCTCCAAAAACGGAAGAGATGGACTAGCACAGCTCGCGCACAGGTTGGCTCTGTGAAGAAGGTAGTGAAAACTGGGAAGGAGCTGAATGGTATAGGCAATACAACCACGAACATGAATGGAATGCATCGAGAACTGTTGTGGCTGCCTAATACTAATGAAAGAGACAGGGCCAACCAGTACGATGTTCAAGATAATGATGATTTCATAGCTTCAGAATCAGATCGGCAATTGCTTCTCATAAAGCAACAAAATGAAGAATTGGATGAGGTCAGTGCTAGCTTGGAGAGAATTGGAGGAGTTGGGCTAACAATTCATGATGAACTCCTTGCCCAGGAGAAAATTATCGATGACTTAGGAATGGAACTGGATAGTACTTCAAATCGTCTTGATTTTGTTCAGGAAGAACTGTACTATGAGAATGTTTCTTCTATTGTTATGTATGAACACTCTCTTAATGCCCCTGAATGCTTCAATGAGATAAGAGCATTGAATTGA 732 41.8 MPSAQDPFYVVKDEIQESIDKVQQTFHRWERISDLGERLQLTNELLGSCESIEWQVDELDKAISVAARDPAWYGIDEVELQKRKRWTSTARAQVGSVKKVVKTGKELNGIGNTTTNMNGMHRELLWLPNTNERDRANQYDVQDNDDFIASESDRQLLLIKQQNEELDEVSASLERIGGVGLTIHDELLAQEKIIDDLGMELDSTSNRLDFVQEELYYENVSSIVMYEHSLNAPECFNEIRALN 243
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
3 41161869 41164729 - BLOR12635 Blo03g01454 58918

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Blo03g01454 243 CDD SNARE_Qc 159 215 - -
Blo03g01454 243 Coils Coil 194 214 - -
Blo03g01454 243 Gene3D - 158 217 - -
Blo03g01454 243 PANTHER SYNTAXIN PROTEIN 1 218 - -
Blo03g01454 243 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 156 218 IPR000727 -
Blo03g01454 243 PANTHER SYNTAXIN 1 218 IPR045242 -
Blo03g01454 243 SUPERFAMILY SNARE fusion complex 155 215 - -
Blo03g01454 243 Pfam Syntaxin 6, N-terminal 6 98 IPR015260 GO:0016020|GO:0048193
Blo03g01454 243 ProSitePatterns Syntaxin / epimorphin family signature. 162 201 IPR006012 GO:0005484|GO:0006886|GO:0016020
Blo03g01454 243 SUPERFAMILY t-snare proteins 5 99 IPR010989 GO:0016020|GO:0016192
Blo03g01454 243 Gene3D - 2 104 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Blo03g01454 K08500 SYP6; syntaxin of plants SYP6 - zju:107433077 328.176
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Blo03g00554 Blo-Chr3:21846350 Blo03g01454 Blo-Chr3:41161869 1.46E-127 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Blo18g00047 . 82 420 SNARE and Associated Proteins AT3G24350 60.1 5.5e-93 338.2
Blo17g00037 BCT 445 752 SNARE and Associated Proteins AT3G24350 62.3 1.9e-90 329.7
Blo04g00912 BCT 1 286 SNARE and Associated Proteins AT2G18260 53.8 5.1e-76 281.6
Blo15g00703 . 102 394 SNARE and Associated Proteins AT2G18260 50.2 4.3e-75 278.5
Blo01g00722 . 1 289 SNARE and Associated Proteins AT2G18260 50.2 1.5e-72 270.0
Blo16g00051 BCT 1 271 SNARE and Associated Proteins AT2G18260 51.6 6.1e-69 258.1
Blo09g00464 . 22 278 SNARE and Associated Proteins AT3G11820 81.3 3.2e-113 405.2
Blo12g00540 . 1 261 SNARE and Associated Proteins AT3G11820 73.6 7.1e-105 377.5
Blo08g00183 . 954 1204 SNARE and Associated Proteins AT3G11820 66.1 3.3e-94 342.0
Blo14g00365 . 31 281 SNARE and Associated Proteins AT3G11820 65.7 1.3e-93 340.1
Blo09g00464 . 29 278 SNARE and Associated Proteins AT3G52400 70.0 2.4e-90 329.3
Blo12g00540 . 13 261 SNARE and Associated Proteins AT3G52400 65.5 7.5e-84 307.8
Blo14g00365 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 9.1e-82 300.8
Blo08g00183 . 924 1204 SNARE and Associated Proteins AT3G52400 56.4 1.2e-81 300.4
Blo14g00365 . 1 299 SNARE and Associated Proteins AT4G03330 67.9 7.8e-109 390.6
Blo08g00183 . 924 1218 SNARE and Associated Proteins AT4G03330 67.1 2.8e-106 382.1
Blo09g00464 . 1 278 SNARE and Associated Proteins AT4G03330 58.0 5.1e-84 308.1
Blo12g00540 . 10 261 SNARE and Associated Proteins AT4G03330 56.7 1.7e-74 276.6
Blo15g00503 . 136 373 SNARE and Associated Proteins AT4G03330 50.8 1.0e-55 214.2
Blo14g00365 . 1 299 SNARE and Associated Proteins AT1G61290 78.3 1.2e-125 446.4
Blo08g00183 . 924 1226 SNARE and Associated Proteins AT1G61290 77.6 5.0e-124 441.0
Blo09g00464 . 1 272 SNARE and Associated Proteins AT1G61290 63.5 3.1e-89 325.5
Blo12g00540 . 13 261 SNARE and Associated Proteins AT1G61290 61.8 6.9e-81 297.7
Blo14g00365 . 1 299 SNARE and Associated Proteins AT1G11250 76.6 1.8e-121 432.6
Blo08g00183 . 924 1226 SNARE and Associated Proteins AT1G11250 75.9 8.7e-121 430.3
Blo09g00464 . 1 272 SNARE and Associated Proteins AT1G11250 64.3 1.2e-93 340.1
Blo12g00540 . 3 261 SNARE and Associated Proteins AT1G11250 61.0 2.2e-84 309.3
Blo15g00503 . 96 396 SNARE and Associated Proteins AT3G03800 59.8 7.7e-88 320.9
Blo12g00540 . 13 277 SNARE and Associated Proteins AT3G03800 51.5 4.0e-60 228.8
Blo15g00503 . 97 293 SNARE and Associated Proteins AT5G08080 60.4 8.4e-52 200.7
Blo02g00982 . 1 263 SNARE and Associated Proteins AT5G16830 61.3 1.4e-75 280.0
Blo03g00106 . 225 443 SNARE and Associated Proteins AT5G16830 57.3 4.7e-60 228.4
Blo02g00982 . 1 274 SNARE and Associated Proteins AT5G46860 69.7 5.9e-84 307.8
Blo03g00106 . 225 414 SNARE and Associated Proteins AT5G46860 76.3 7.5e-71 264.2
Blo02g00982 . 1 257 SNARE and Associated Proteins AT4G17730 65.8 8.9e-77 283.9
Blo03g00106 . 225 414 SNARE and Associated Proteins AT4G17730 76.2 3.5e-73 271.9
Blo18g00562 BCT 1 182 SNARE and Associated Proteins AT4G17730 51.5 1.1e-42 170.6
Blo02g00982 . 65 256 SNARE and Associated Proteins AT1G32270 59.4 9.2e-50 194.5
Blo03g00106 . 289 440 SNARE and Associated Proteins AT1G32270 64.5 1.2e-44 177.6
Blo04g00243 . 1 337 SNARE and Associated Proteins AT5G05760 65.8 2.4e-111 399.1
Blo18g00047 . 82 420 SNARE and Associated Proteins AT3G24350 60.1 5.5e-93 338.2
Blo17g00037 BCT 445 752 SNARE and Associated Proteins AT3G24350 62.3 1.9e-90 329.7
Blo18g00633 . 1 341 SNARE and Associated Proteins AT5G26980 74.8 9.1e-124 440.3
Blo17g00673 . 115 418 SNARE and Associated Proteins AT5G26980 71.4 1.6e-112 402.9
Blo18g00633 . 1 339 SNARE and Associated Proteins AT4G02195 62.8 2.1e-99 359.4
Blo17g00673 . 115 416 SNARE and Associated Proteins AT4G02195 60.9 7.1e-92 334.3
Blo18g00633 . 1 339 SNARE and Associated Proteins AT3G05710 74.9 4.5e-126 448.0
Blo17g00673 . 115 416 SNARE and Associated Proteins AT3G05710 71.7 2.6e-113 405.6
Blo03g00538 . 1 220 SNARE and Associated Proteins AT1G16240 72.7 2.3e-84 308.9
Blo07g00879 . 34 267 SNARE and Associated Proteins AT1G16240 58.5 7.1e-70 260.8
Blo03g00538 . 1 220 SNARE and Associated Proteins AT1G79590 71.8 2.0e-84 309.3
Blo07g00879 . 34 267 SNARE and Associated Proteins AT1G79590 59.8 1.6e-70 263.1
Blo03g00554 . 55 234 SNARE and Associated Proteins AT1G28490 66.1 5.8e-60 227.6
Blo03g01454 . 55 215 SNARE and Associated Proteins AT1G28490 60.9 1.6e-49 193.0
Blo07g01404 . 1 248 SNARE and Associated Proteins AT3G09740 72.4 4.0e-93 338.2
Blo14g00167 . 1 233 SNARE and Associated Proteins AT3G09740 61.0 4.8e-70 261.5
Blo07g01404 . 1 248 SNARE and Associated Proteins AT3G45280 60.4 5.5e-74 274.6
Blo14g00167 . 1 236 SNARE and Associated Proteins AT3G45280 57.7 1.4e-66 250.0
Blo07g01404 . 1 248 SNARE and Associated Proteins AT3G61450 60.6 5.2e-77 284.6
Blo14g00167 . 1 235 SNARE and Associated Proteins AT3G61450 53.8 3.6e-62 235.3
Blo04g00134 . 624 868 SNARE and Associated Proteins AT1G51740 72.4 2.7e-91 332.0
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003549 2 1 2 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 5 4 0 44
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Blo03g01454 Blo_Chr03 FPKM 112.16819 104.409576 0.620667 1.183878 0.622924 0.0 0.0 0.898731 0.8953 0.653164