Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Blo09g00155 ATGGCACTCTCTTCACCATATTTCGCTGGAAAGGCAGTGAAGCTCTCTCCCTCTGCTTCAGACATTGTCGGAAATGGAAAAGTCAGCATGAGGAAGACCGTCGGTAAGGCCGTCTTTTCTAGCAGCCCATGGTATGGCCTGGACCTTGTAAAGTACTTGGGTCCATTCTCTGGCGAGGCTCCGTCCTACCTAACTGGAGAATTCCCAGGAGATTATGGTTGGGATATCGCCGGGCTCTCTGCGGATCCAGAGACATTCACAAAGAACCAGGAGCTTGAAGTCGTCCACTCGAGGTGGGCCATTCTCGGAGCCCTAGGCTGCGTATTCCTGGAGCTTCTATCCCGGAACGGAGTGAAGTTCGGAGAGGCAGTGTGGTTCAAGGCGGGATCTCAGATATTCAGCGACGTAGGACTAGAATACTTGGGCAACCCGAGCTTGGTCCATGCTCAGAGCATCTTAGCCATCTGGGCTTGCCAGGTGGTTTTGATGGGAGCCGTGGAAGGCTATCGTATTGCTGGAGGACCACTGGGAGAAGTCACCGACTCAATCTATCCCAGAGGGTCGTTTGACCCGTTGGGTCTGGCGGACGAGCCAGAGGCATTTGCGGAGCTGAAAGTGAAGGAGTTAAAGAATGGAAGATTAGCCATGTTCTCGATGTTCGGATTTTTCGTTCAGGCCATTGTCACCAGAAAAGGACCTTTGGAGAATTTGGCCGACCACCTTGCCGACCCTGTTAACAACAACGCCTGCGCTTATGCAACCAACTTTGTTCCAGGAAAGTGA 783 52.49 MALSSPYFAGKAVKLSPSASDIVGNGKVSMRKTVGKAVFSSSPWYGLDLVKYLGPFSGEAPSYLTGEFPGDYGWDIAGLSADPETFTKNQELEVVHSRWAILGALGCVFLELLSRNGVKFGEAVWFKAGSQIFSDVGLEYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDSIYPRGSFDPLGLADEPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTRKGPLENLADHLADPVNNNACAYATNFVPGK 260
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
9 4530814 4531596 - BLOR21070 Blo09g00155 64782

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Blo09g00155 260 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 3, CHLOROPLASTIC 1 260 - -
Blo09g00155 260 SUPERFAMILY Chlorophyll a-b binding protein 43 257 - -
Blo09g00155 260 Pfam Chlorophyll A-B binding protein 60 226 IPR022796 -
Blo09g00155 260 Gene3D Chlorophyll a/b binding protein domain 51 253 - -
Blo09g00155 260 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 1 260 IPR001344 GO:0009765|GO:0016020
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Blo09g00155 K08912 LHCB1; light-harvesting complex II chlorophyll a/b binding protein 1 - rcu:8264152 469.159
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Blo09g00155 Blo-Chr9:4530814 Blo14g00843 Blo-Chr14:30803394 2.82E-166 dispersed
Blo09g00155 Blo-Chr9:4530814 Blo14g00842 Blo-Chr14:30800478 1.79E-164 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Blo03g01240 . 1 448 Chloroplast and Mitochondria Gene Families AT2G28800 60.3 5.1e-138 488.0
Blo16g01179 . 67 431 Chloroplast and Mitochondria Gene Families AT2G28800 54.5 3.0e-98 355.9
Blo02g00876 . 3 254 Chloroplast and Mitochondria Gene Families AT1G15820 76.2 1.9e-111 399.1
Blo15g00783 . 3 254 Chloroplast and Mitochondria Gene Families AT1G15820 74.6 4.6e-110 394.4
Blo02g00138 BCT 1 267 Chloroplast and Mitochondria Gene Families AT3G27690 91.0 1.5e-144 509.2
Blo15g00451 BCT 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 90.2 2.1e-143 505.4
Blo07g00489 . 2 261 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 6.7e-121 430.6
Blo14g00843 . 3 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.8 3.3e-120 428.3
Blo14g00842 . 2 264 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 4.8e-119 424.5
Blo07g00613 . 7 227 Chloroplast and Mitochondria Gene Families AT3G27690 81.9 4.8e-111 397.9
Blo09g00155 . 2 260 Chloroplast and Mitochondria Gene Families AT3G27690 72.2 2.9e-108 388.7
Blo03g01424 . 764 977 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 5.0e-92 334.7
Blo16g00889 . 103 324 Chloroplast and Mitochondria Gene Families AT3G27690 50.9 1.1e-54 210.7
Blo01g01695 . 71 274 Chloroplast and Mitochondria Gene Families AT3G27690 54.3 1.1e-51 200.7
Blo09g00381 . 5 268 Chloroplast and Mitochondria Gene Families AT3G61470 79.2 3.6e-123 438.0
Blo07g01231 . 86 256 Chloroplast and Mitochondria Gene Families AT3G61470 90.6 2.2e-96 349.0
Blo01g00576 . 26 252 Chloroplast and Mitochondria Gene Families AT3G61470 59.1 4.0e-82 301.6
Blo04g00773 CCT,ECH 22 250 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 3.2e-63 238.8
Blo04g00315 BCT 63 260 Chloroplast and Mitochondria Gene Families AT3G54890 79.8 7.4e-90 327.0
Blo13g00725 BCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.8 2.8e-89 325.1
Blo07g01143 . 1 286 Chloroplast and Mitochondria Gene Families AT3G08940 84.3 6.8e-139 490.3
Blo11g00311 . 1 261 Chloroplast and Mitochondria Gene Families AT3G08940 84.8 7.3e-125 443.7
Blo16g00889 . 28 331 Chloroplast and Mitochondria Gene Families AT1G76570 77.7 9.5e-145 510.0
Blo03g01344 . 1 272 Chloroplast and Mitochondria Gene Families AT1G61520 84.6 1.1e-133 473.0
Blo03g01011 . 227 451 Chloroplast and Mitochondria Gene Families AT1G61520 88.4 6.8e-120 427.2
Blo15g00451 BCT 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.8 5.5e-143 503.8
Blo02g00138 BCT 1 267 Chloroplast and Mitochondria Gene Families AT2G05070 90.3 9.4e-143 503.1
Blo07g00489 . 5 261 Chloroplast and Mitochondria Gene Families AT2G05070 78.4 2.3e-120 428.7
Blo14g00843 . 6 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.3e-120 428.7
Blo14g00842 . 5 264 Chloroplast and Mitochondria Gene Families AT2G05070 78.1 3.3e-119 424.9
Blo07g00613 . 7 227 Chloroplast and Mitochondria Gene Families AT2G05070 81.9 9.5e-111 396.7
Blo09g00155 . 2 260 Chloroplast and Mitochondria Gene Families AT2G05070 72.3 4.4e-108 387.9
Blo03g01424 . 764 977 Chloroplast and Mitochondria Gene Families AT2G05070 77.2 4.4e-92 334.7
Blo01g01695 . 71 274 Chloroplast and Mitochondria Gene Families AT2G05070 54.8 7.7e-52 201.1
Blo02g00138 BCT 1 239 Chloroplast and Mitochondria Gene Families AT2G05100 91.2 4.3e-126 448.0
Blo15g00451 BCT 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 90.3 7.3e-126 447.2
Blo14g00843 . 6 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.7 5.7e-102 367.9
Blo07g00489 . 5 233 Chloroplast and Mitochondria Gene Families AT2G05100 76.3 1.6e-101 366.3
Blo14g00842 . 5 236 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 6.3e-101 364.4
Blo07g00613 . 7 199 Chloroplast and Mitochondria Gene Families AT2G05100 80.3 1.4e-92 336.7
Blo09g00155 . 2 232 Chloroplast and Mitochondria Gene Families AT2G05100 70.8 1.2e-91 333.6
Blo03g01424 . 764 949 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 2.4e-76 282.7
Blo01g01695 . 71 258 Chloroplast and Mitochondria Gene Families AT2G05100 53.6 2.7e-43 172.9
Blo07g01143 . 4 168 Chloroplast and Mitochondria Gene Families AT2G40100 69.6 4.7e-64 241.1
Blo11g00311 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 69.2 5.2e-63 237.7
Blo14g00843 . 2 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.9 2.0e-137 485.3
Blo14g00842 . 1 264 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 8.6e-136 479.9
Blo07g00489 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.1e-135 479.6
Blo09g00155 . 1 260 Chloroplast and Mitochondria Gene Families AT1G29930 84.0 8.9e-125 443.4
Blo07g00613 . 1 227 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 1.1e-117 419.9
Blo02g00138 BCT 35 267 Chloroplast and Mitochondria Gene Families AT1G29930 84.8 1.4e-117 419.5
Blo15g00451 BCT 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 6.9e-117 417.2
Blo03g01424 . 764 977 Chloroplast and Mitochondria Gene Families AT1G29930 76.3 4.5e-92 334.7
Blo01g01695 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29930 52.9 2.0e-52 203.0
Blo14g00843 . 2 265 Chloroplast and Mitochondria Gene Families AT1G29920 89.5 7.8e-137 483.4
Blo14g00842 . 1 264 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 3.3e-135 478.0
Blo07g00489 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 4.3e-135 477.6
Blo09g00155 . 1 260 Chloroplast and Mitochondria Gene Families AT1G29920 83.6 3.4e-124 441.4
Blo07g00613 . 1 227 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 1.1e-117 419.9
Blo02g00138 BCT 35 267 Chloroplast and Mitochondria Gene Families AT1G29920 84.8 1.4e-117 419.5
Blo15g00451 BCT 33 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.4 9.0e-117 416.8
Blo03g01424 . 764 977 Chloroplast and Mitochondria Gene Families AT1G29920 76.3 4.5e-92 334.7
Blo01g01695 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29920 52.9 2.0e-52 203.0
Blo14g00843 . 2 265 Chloroplast and Mitochondria Gene Families AT1G29910 89.5 7.8e-137 483.4
Blo14g00842 . 1 264 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 3.3e-135 478.0
Blo07g00489 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 4.3e-135 477.6
Blo09g00155 . 1 260 Chloroplast and Mitochondria Gene Families AT1G29910 83.6 3.4e-124 441.4
Blo07g00613 . 1 227 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 1.1e-117 419.9
Blo02g00138 BCT 35 267 Chloroplast and Mitochondria Gene Families AT1G29910 84.8 1.4e-117 419.5
Blo15g00451 BCT 33 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.4 9.0e-117 416.8
Blo03g01424 . 764 977 Chloroplast and Mitochondria Gene Families AT1G29910 76.3 4.5e-92 334.7
Blo01g01695 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29910 52.9 2.0e-52 203.0
Blo01g01695 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 85.7 9.3e-141 496.5
Blo07g00489 . 34 249 Chloroplast and Mitochondria Gene Families AT4G10340 51.4 1.3e-57 220.3
Blo14g00843 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 3.2e-56 215.7
Blo02g00138 BCT 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 9.2e-56 214.2
Blo14g00842 . 48 252 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 1.6e-55 213.4
Blo15g00451 BCT 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 2.1e-55 213.0
Blo07g00613 . 16 215 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 4.6e-55 211.8
Blo14g00843 . 2 265 Chloroplast and Mitochondria Gene Families AT2G34420 89.1 8.5e-136 479.9
Blo14g00842 . 1 264 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 3.6e-134 474.6
Blo07g00489 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 5.2e-133 470.7
Blo09g00155 . 1 260 Chloroplast and Mitochondria Gene Families AT2G34420 84.0 3.7e-123 438.0
Blo07g00613 . 1 227 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 4.7e-118 421.0
Blo02g00138 BCT 3 267 Chloroplast and Mitochondria Gene Families AT2G34420 76.6 1.4e-117 419.5
Blo15g00451 BCT 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.4 1.5e-116 416.0
Blo03g01424 . 764 977 Chloroplast and Mitochondria Gene Families AT2G34420 76.7 7.6e-92 334.0
Blo01g01695 . 71 274 Chloroplast and Mitochondria Gene Families AT2G34420 52.4 5.9e-52 201.4
Blo14g00843 . 2 265 Chloroplast and Mitochondria Gene Families AT2G34430 89.5 1.0e-136 483.0
Blo14g00842 . 1 264 Chloroplast and Mitochondria Gene Families AT2G34430 89.1 4.3e-135 477.6
Blo07g00489 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 8.0e-134 473.4
Blo09g00155 . 1 260 Chloroplast and Mitochondria Gene Families AT2G34430 82.4 1.4e-122 436.0
Blo07g00613 . 7 227 Chloroplast and Mitochondria Gene Families AT2G34430 89.4 8.9e-117 416.8
Blo02g00138 BCT 35 267 Chloroplast and Mitochondria Gene Families AT2G34430 84.7 2.6e-116 415.2
Blo15g00451 BCT 33 265 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 9.9e-116 413.3
Blo03g01424 . 764 977 Chloroplast and Mitochondria Gene Families AT2G34430 76.7 7.6e-92 334.0
Blo01g01695 . 71 274 Chloroplast and Mitochondria Gene Families AT2G34430 52.4 7.7e-52 201.1
Blo07g01143 . 2 286 Chloroplast and Mitochondria Gene Families AT5G01530 84.4 1.6e-140 495.7
Blo11g00311 . 1 261 Chloroplast and Mitochondria Gene Families AT5G01530 82.7 3.4e-122 434.9
Blo17g00322 . 552 811 Chloroplast and Mitochondria Gene Families AT5G40810 94.2 1.7e-144 508.8
Blo18g00305 . 604 863 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 9.3e-143 503.1
Blo17g00322 . 505 811 Chloroplast and Mitochondria Gene Families AT3G27240 87.1 1.2e-152 536.2
Blo18g00305 . 557 863 Chloroplast and Mitochondria Gene Families AT3G27240 85.0 2.7e-149 525.0
Blo03g01202 CCT,ECH 4 327 Chloroplast and Mitochondria Gene Families AT2G30160 73.5 4.2e-140 494.6
Blo14g00065 BCT,CCT,ECH 1 323 Chloroplast and Mitochondria Gene Families AT2G30160 73.2 3.9e-138 488.0
Blo13g01027 BCT,CCT,ECH 5 323 Chloroplast and Mitochondria Gene Families AT2G30160 73.1 1.9e-137 485.7
Blo11g00315 . 11 326 Chloroplast and Mitochondria Gene Families AT2G30160 65.5 5.5e-116 414.5
Blo13g01027 BCT,CCT,ECH 1 323 Chloroplast and Mitochondria Gene Families AT1G07030 73.5 1.5e-137 486.1
Blo14g00065 BCT,CCT,ECH 1 323 Chloroplast and Mitochondria Gene Families AT1G07030 72.8 2.5e-137 485.3
Blo03g01202 CCT,ECH 4 331 Chloroplast and Mitochondria Gene Families AT1G07030 70.4 4.9e-133 471.1
Blo11g00315 . 15 326 Chloroplast and Mitochondria Gene Families AT1G07030 69.0 2.0e-118 422.5
Blo10g00071 . 1 286 Chloroplast and Mitochondria Gene Families AT2G47490 76.0 1.1e-121 433.3
Blo16g00730 . 540 841 Chloroplast and Mitochondria Gene Families AT2G47490 61.8 4.4e-107 384.8
Blo16g00730 . 541 836 Chloroplast and Mitochondria Gene Families AT1G25380 71.3 4.6e-116 414.8
Blo10g00071 . 16 286 Chloroplast and Mitochondria Gene Families AT1G25380 65.8 3.3e-98 355.5
Blo01g00828 . 1 583 Chloroplast and Mitochondria Gene Families AT4G21490 74.7 2.0e-254 875.2
Blo02g00094 BCT,CCT 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 69.3 2.7e-235 811.6
Blo04g00667 CCT 9 574 Chloroplast and Mitochondria Gene Families AT4G21490 65.9 7.9e-227 783.5
Blo15g00544 . 44 277 Chloroplast and Mitochondria Gene Families AT4G21490 50.2 2.2e-59 227.3
Blo06g00742 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.9 2.8e-61 231.9
Blo17g00591 . 4 178 Chloroplast and Mitochondria Gene Families AT1G17530 57.1 2.2e-50 195.7
Blo17g00591 . 4 182 Chloroplast and Mitochondria Gene Families AT3G04800 57.2 7.9e-51 197.2
Blo06g00742 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 53.2 9.6e-41 163.7
Blo06g00742 . 6 190 Chloroplast and Mitochondria Gene Families AT1G72750 65.6 1.5e-62 236.1
Blo17g00591 . 4 182 Chloroplast and Mitochondria Gene Families AT1G72750 58.2 1.9e-52 202.6
Blo01g00480 . 7 240 Chloroplast and Mitochondria Gene Families AT1G26100 65.7 1.6e-80 296.2
Blo17g00410 . 1 223 Chloroplast and Mitochondria Gene Families AT5G38630 73.7 1.9e-91 332.4
Blo11g00348 . 1 227 Chloroplast and Mitochondria Gene Families AT5G38630 66.2 4.6e-85 311.2
Blo06g01119 . 62 271 Chloroplast and Mitochondria Gene Families AT4G25570 62.2 2.2e-73 272.7
Blo16g00707 . 6 224 Chloroplast and Mitochondria Gene Families AT1G14730 56.2 3.8e-68 255.0
Blo18g00547 . 9 371 Chloroplast and Mitochondria Gene Families AT5G14040 82.3 5.5e-173 604.0
Blo16g00771 . 65 431 Chloroplast and Mitochondria Gene Families AT5G14040 78.0 7.3e-165 577.0
Blo13g00467 . 10 292 Chloroplast and Mitochondria Gene Families AT5G14040 51.9 8.2e-84 307.8
Blo18g00547 . 10 368 Chloroplast and Mitochondria Gene Families AT3G48850 70.0 6.8e-144 507.3
Blo16g00771 . 66 430 Chloroplast and Mitochondria Gene Families AT3G48850 67.8 4.9e-142 501.1
Blo13g00467 . 10 292 Chloroplast and Mitochondria Gene Families AT3G48850 50.2 9.7e-82 300.8
Blo16g00710 . 121 244 Chloroplast and Mitochondria Gene Families AT3G48850 62.9 2.2e-41 166.8
Blo13g00467 . 6 291 Chloroplast and Mitochondria Gene Families AT2G17270 73.9 6.5e-127 450.7
Blo18g00547 . 70 367 Chloroplast and Mitochondria Gene Families AT2G17270 52.8 7.2e-86 314.3
Blo16g00771 . 128 425 Chloroplast and Mitochondria Gene Families AT2G17270 51.5 8.8e-84 307.4
Blo10g00165 . 42 303 Chloroplast and Mitochondria Gene Families AT5G15640 71.2 1.1e-100 363.6
Blo05g00051 . 5497 5844 Chloroplast and Mitochondria Gene Families AT5G26200 59.9 1.7e-112 402.9
Blo06g00744 . 1 346 Chloroplast and Mitochondria Gene Families AT5G26200 60.4 2.5e-111 399.1
Blo01g01453 . 12 222 Chloroplast and Mitochondria Gene Families AT5G26200 68.7 2.9e-80 295.8
Blo05g00051 . 5497 5848 Chloroplast and Mitochondria Gene Families AT1G72820 75.1 2.9e-147 518.5
Blo06g00744 . 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 75.3 7.8e-145 510.4
Blo01g01453 . 1 226 Chloroplast and Mitochondria Gene Families AT1G72820 65.5 4.8e-78 288.5
Blo03g00347 . 99 305 Chloroplast and Mitochondria Gene Families AT5G52570 51.7 1.8e-49 193.0
Blo09g00065 . 1 218 Chloroplast and Mitochondria Gene Families AT4G25700 62.4 2.1e-71 265.8
Blo03g00347 . 49 221 Chloroplast and Mitochondria Gene Families AT4G25700 62.6 7.6e-61 230.7
Blo03g01422 . 79 271 Chloroplast and Mitochondria Gene Families AT5G54290 89.7 1.5e-90 330.1
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Blo09g00155 Blo_Chr09 FPKM 5.647876 6.713789 39.075699 40.194122 4.654755 4.409133 5.086431 58.538349 59.725712 66.101883