Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Blo14g00167 ATGAGCGTGATCGACATTCTCTTCCGGGTCGACGCTATATGCAAGAGGTACGACAAGTACGATATTGAAAAACAACGCGAACTCAATACCTATGGCGATGACGCCTTTGCTCGCCTCTATGCCGTCGTTGAAGCCGACATTGAATCATCTCTTCAGAAGTCTGCAATGGCTGCAGCTGATCAGAACAGGGCGTCTGCGGCTGCGCTGAACGCAGAGATAAGGTCAAAAAAGGCCCGATTAATGGATGAAGTTTTAAAGTTGAAGAAATTGAACCAGAAGAAGGTGAAGGGCCTGTCGAAAGAAGAACAGGCCATTCGTGAGGATTTGGTTCTTGCACTACCAGACAGGATTCAAGCAATTCGAGATGGAACGACCAATGCAGCCAAAATCTCTGGAGGATTGGCTTCTTCAACATCCCATAAAAATATCAAATTTGACTCCTCAGGTGAATGTTTTGAGAGTGAATACTTTGAGCAATCCGAAGAAGGGAACCGGTTTAGGCAAGAGTATGAACTACGCAAAATGAAACAGGCATGTCTAGGCATAATATCCGAAGGATTGGACACTTTGAAAAATCTGGCACTTGATATGAACGAGGAAATGGATCGACAGGTTCCGTTGATTGACGAGATCGATACAAAGGTCGACAAGGTGACTTCTGATCTGAGAAACACGAATGTTAGGCTCAAGGAGAATCTCTTCAAGGTTCCTCATCTGGATGAGATCCAGCCGAAACTTCTGCATCGACATTATCCTGCTGTGTGTAATTCTGGGCATAGTTTCGTACTTATACAATATTTTGAACTGAGGCAGATGCTTCTCGGCCATCTTCTTCTCGAAGAGATGGGACTTTGA 855 44.68 MSVIDILFRVDAICKRYDKYDIEKQRELNTYGDDAFARLYAVVEADIESSLQKSAMAAADQNRASAAALNAEIRSKKARLMDEVLKLKKLNQKKVKGLSKEEQAIREDLVLALPDRIQAIRDGTTNAAKISGGLASSTSHKNIKFDSSGECFESEYFEQSEEGNRFRQEYELRKMKQACLGIISEGLDTLKNLALDMNEEMDRQVPLIDEIDTKVDKVTSDLRNTNVRLKENLFKVPHLDEIQPKLLHRHYPAVCNSGHSFVLIQYFELRQMLLGHLLLEEMGL 284
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
14 1295619 1297278 + BLOR14485 Blo14g00167 69680

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Blo14g00167 284 SUPERFAMILY SNARE fusion complex 178 230 - -
Blo14g00167 284 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 183 232 IPR000727 -
Blo14g00167 284 Coils Coil 70 90 - -
Blo14g00167 284 CDD SNARE_Qc 180 231 - -
Blo14g00167 284 PANTHER SYNTAXIN 1 233 IPR045242 -
Blo14g00167 284 Gene3D - 178 231 - -
Blo14g00167 284 PANTHER SYNTAXIN-73 1 233 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Blo14g00167 K08506 SYP7; syntaxin of plants SYP7 - jre:108990055 322.013
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Blo14g00167 Blo-Chr14:1295619 Blo07g01404 Blo-Chr7:34080193 2.41E-95 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Blo18g00047 . 82 420 SNARE and Associated Proteins AT3G24350 60.1 5.5e-93 338.2
Blo17g00037 BCT 445 752 SNARE and Associated Proteins AT3G24350 62.3 1.9e-90 329.7
Blo04g00912 BCT 1 286 SNARE and Associated Proteins AT2G18260 53.8 5.1e-76 281.6
Blo15g00703 . 102 394 SNARE and Associated Proteins AT2G18260 50.2 4.3e-75 278.5
Blo01g00722 . 1 289 SNARE and Associated Proteins AT2G18260 50.2 1.5e-72 270.0
Blo16g00051 BCT 1 271 SNARE and Associated Proteins AT2G18260 51.6 6.1e-69 258.1
Blo09g00464 . 22 278 SNARE and Associated Proteins AT3G11820 81.3 3.2e-113 405.2
Blo12g00540 . 1 261 SNARE and Associated Proteins AT3G11820 73.6 7.1e-105 377.5
Blo08g00183 . 954 1204 SNARE and Associated Proteins AT3G11820 66.1 3.3e-94 342.0
Blo14g00365 . 31 281 SNARE and Associated Proteins AT3G11820 65.7 1.3e-93 340.1
Blo09g00464 . 29 278 SNARE and Associated Proteins AT3G52400 70.0 2.4e-90 329.3
Blo12g00540 . 13 261 SNARE and Associated Proteins AT3G52400 65.5 7.5e-84 307.8
Blo14g00365 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 9.1e-82 300.8
Blo08g00183 . 924 1204 SNARE and Associated Proteins AT3G52400 56.4 1.2e-81 300.4
Blo14g00365 . 1 299 SNARE and Associated Proteins AT4G03330 67.9 7.8e-109 390.6
Blo08g00183 . 924 1218 SNARE and Associated Proteins AT4G03330 67.1 2.8e-106 382.1
Blo09g00464 . 1 278 SNARE and Associated Proteins AT4G03330 58.0 5.1e-84 308.1
Blo12g00540 . 10 261 SNARE and Associated Proteins AT4G03330 56.7 1.7e-74 276.6
Blo15g00503 . 136 373 SNARE and Associated Proteins AT4G03330 50.8 1.0e-55 214.2
Blo14g00365 . 1 299 SNARE and Associated Proteins AT1G61290 78.3 1.2e-125 446.4
Blo08g00183 . 924 1226 SNARE and Associated Proteins AT1G61290 77.6 5.0e-124 441.0
Blo09g00464 . 1 272 SNARE and Associated Proteins AT1G61290 63.5 3.1e-89 325.5
Blo12g00540 . 13 261 SNARE and Associated Proteins AT1G61290 61.8 6.9e-81 297.7
Blo14g00365 . 1 299 SNARE and Associated Proteins AT1G11250 76.6 1.8e-121 432.6
Blo08g00183 . 924 1226 SNARE and Associated Proteins AT1G11250 75.9 8.7e-121 430.3
Blo09g00464 . 1 272 SNARE and Associated Proteins AT1G11250 64.3 1.2e-93 340.1
Blo12g00540 . 3 261 SNARE and Associated Proteins AT1G11250 61.0 2.2e-84 309.3
Blo15g00503 . 96 396 SNARE and Associated Proteins AT3G03800 59.8 7.7e-88 320.9
Blo12g00540 . 13 277 SNARE and Associated Proteins AT3G03800 51.5 4.0e-60 228.8
Blo15g00503 . 97 293 SNARE and Associated Proteins AT5G08080 60.4 8.4e-52 200.7
Blo02g00982 . 1 263 SNARE and Associated Proteins AT5G16830 61.3 1.4e-75 280.0
Blo03g00106 . 225 443 SNARE and Associated Proteins AT5G16830 57.3 4.7e-60 228.4
Blo02g00982 . 1 274 SNARE and Associated Proteins AT5G46860 69.7 5.9e-84 307.8
Blo03g00106 . 225 414 SNARE and Associated Proteins AT5G46860 76.3 7.5e-71 264.2
Blo02g00982 . 1 257 SNARE and Associated Proteins AT4G17730 65.8 8.9e-77 283.9
Blo03g00106 . 225 414 SNARE and Associated Proteins AT4G17730 76.2 3.5e-73 271.9
Blo18g00562 BCT 1 182 SNARE and Associated Proteins AT4G17730 51.5 1.1e-42 170.6
Blo02g00982 . 65 256 SNARE and Associated Proteins AT1G32270 59.4 9.2e-50 194.5
Blo03g00106 . 289 440 SNARE and Associated Proteins AT1G32270 64.5 1.2e-44 177.6
Blo04g00243 . 1 337 SNARE and Associated Proteins AT5G05760 65.8 2.4e-111 399.1
Blo18g00047 . 82 420 SNARE and Associated Proteins AT3G24350 60.1 5.5e-93 338.2
Blo17g00037 BCT 445 752 SNARE and Associated Proteins AT3G24350 62.3 1.9e-90 329.7
Blo18g00633 . 1 341 SNARE and Associated Proteins AT5G26980 74.8 9.1e-124 440.3
Blo17g00673 . 115 418 SNARE and Associated Proteins AT5G26980 71.4 1.6e-112 402.9
Blo18g00633 . 1 339 SNARE and Associated Proteins AT4G02195 62.8 2.1e-99 359.4
Blo17g00673 . 115 416 SNARE and Associated Proteins AT4G02195 60.9 7.1e-92 334.3
Blo18g00633 . 1 339 SNARE and Associated Proteins AT3G05710 74.9 4.5e-126 448.0
Blo17g00673 . 115 416 SNARE and Associated Proteins AT3G05710 71.7 2.6e-113 405.6
Blo03g00538 . 1 220 SNARE and Associated Proteins AT1G16240 72.7 2.3e-84 308.9
Blo07g00879 . 34 267 SNARE and Associated Proteins AT1G16240 58.5 7.1e-70 260.8
Blo03g00538 . 1 220 SNARE and Associated Proteins AT1G79590 71.8 2.0e-84 309.3
Blo07g00879 . 34 267 SNARE and Associated Proteins AT1G79590 59.8 1.6e-70 263.1
Blo03g00554 . 55 234 SNARE and Associated Proteins AT1G28490 66.1 5.8e-60 227.6
Blo03g01454 . 55 215 SNARE and Associated Proteins AT1G28490 60.9 1.6e-49 193.0
Blo07g01404 . 1 248 SNARE and Associated Proteins AT3G09740 72.4 4.0e-93 338.2
Blo14g00167 . 1 233 SNARE and Associated Proteins AT3G09740 61.0 4.8e-70 261.5
Blo07g01404 . 1 248 SNARE and Associated Proteins AT3G45280 60.4 5.5e-74 274.6
Blo14g00167 . 1 236 SNARE and Associated Proteins AT3G45280 57.7 1.4e-66 250.0
Blo07g01404 . 1 248 SNARE and Associated Proteins AT3G61450 60.6 5.2e-77 284.6
Blo14g00167 . 1 235 SNARE and Associated Proteins AT3G61450 53.8 3.6e-62 235.3
Blo04g00134 . 624 868 SNARE and Associated Proteins AT1G51740 72.4 2.7e-91 332.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Blo14g00167 Blo_Chr14 FPKM 12.879024 15.39135 27.964231 28.455511 22.449232 21.959782 22.411398 38.850311 36.477005 37.744049