Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bma01g00945 ATGGCCGGGGGAATCATGTGGCAGTTATTGAGGAGGAAAATTCAGTCTCACAATACTGCCTCTCCAAATATTTCATCCCTCATCTCTAAAAAAGATGATCTTGGACCTGGTTTTATGAAGTCCCTTAGAGCTCTTGCACTTGTTGGAGCTGGTGTTTCTGGGTTCTTGAGCTTTGCAACATTAGCTTCTGCAGATGAAGCTGAACATGGCTTGGAATGTCCAAGCTATCCCTGGCCCCACAAGGGTATTCTGAGTTCATATGATCATGCTTCGATTCGTCGTGGCCATCAAGTTTACCAACAAGTCTGTGCTTCATGTCATTCCATGTCTTTAATATCGTACCGTGATTTGGTCGGTGTTGCATATACAGAAGAAGAGACAAAAGCAATGGCTGCTGAGATTGAGGTTGTTGATGGGCCTAATGATGAAGGCGAGATGTTCACTCGCCCTGGTAAACTTAGTGACCGGTTTCCTCAACCATATTCCAATGAACAAGCTGCGAGGTTTGCCAATGGAGGGGCATATCCTCCTGATTTAAGTCTCATGACAAAAGCCCGCCACAATGGACAGAACTATGTATTTGCCCTTCTAACTGGTTACCGCGATCCTCCTGCTGGTGTTTCGATAAGAGAAGGTTTGCATTATAATCCTTATTTTCCTGGGGGTGCTATTGCGATGCCAAAAATGCTTAACGATGGTGCTGTTGAGTACGAGGATGGTACTCCTGCAACAGAAGCTCAGATGGGAAAAGACGTGGTGACTTTCTTGTCATGGGCTGCAGAACCCGAAATGGAAGAGAGGAAATTGATGGGATTCAAGTGGATATTTGTTCTCTCGCTTGCTCTACTTCAAGCAGCCTATTACCGGCGCTTAAAGTGGTCGGTTCTGAAGTCGCGCAAGTTAGTTCTCGACGTGGTGAACTAG 924 45.78 MAGGIMWQLLRRKIQSHNTASPNISSLISKKDDLGPGFMKSLRALALVGAGVSGFLSFATLASADEAEHGLECPSYPWPHKGILSSYDHASIRRGHQVYQQVCASCHSMSLISYRDLVGVAYTEEETKAMAAEIEVVDGPNDEGEMFTRPGKLSDRFPQPYSNEQAARFANGGAYPPDLSLMTKARHNGQNYVFALLTGYRDPPAGVSIREGLHYNPYFPGGAIAMPKMLNDGAVEYEDGTPATEAQMGKDVVTFLSWAAEPEMEERKLMGFKWIFVLSLALLQAAYYRRLKWSVLKSRKLVLDVVN 307
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
1 9190684 9192902 + Bma001176.1 Bma01g00945 75462

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bma01g00945 307 Pfam Cytochrome C1 family 78 294 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 212 223 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 243 262 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 141 161 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 262 277 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 76 95 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 174 198 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 223 242 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 PRINTS Cytochrome C1 signature 96 115 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 Gene3D - 67 262 IPR036909 GO:0009055|GO:0020037
Bma01g00945 307 PANTHER CYTOCHROME C1-1, HEME PROTEIN, MITOCHONDRIAL 17 307 - -
Bma01g00945 307 SUPERFAMILY Cytochrome c 71 261 IPR036909 GO:0009055|GO:0020037
Bma01g00945 307 ProSiteProfiles Cytochrome c family profile. 90 197 IPR009056 GO:0009055|GO:0020037
Bma01g00945 307 PANTHER CYTOCHROME C1 17 307 IPR002326 GO:0009055|GO:0020037
Bma01g00945 307 Gene3D - 263 306 - -
Bma01g00945 307 SUPERFAMILY Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 262 306 IPR021157 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bma01g00945 K00413 CYC1, CYT1, petC; ubiquinol-cytochrome c reductase cytochrome c1 subunit - qsu:111999908 560.836
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g1214 . . Bda01g01310 Bda13g01648 Bpe02g01522 Bpe14g00222 . . . . . . . . . . . . . . . . . . . . . . . . . Cone11ag0071 Cone18ag1406 . . . . . . . Blo18g00305 . . . . Bma01g00945 . . . . . . . . . . . . . . . . . . . . . . . . . . . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bma07g01536 . 1 482 Chloroplast and Mitochondria Gene Families AT2G28800 56.5 8.1e-135 477.2
Bma06g00591 . 57 426 Chloroplast and Mitochondria Gene Families AT2G28800 54.1 7.9e-98 354.4
Bma05g00575 . 3 254 Chloroplast and Mitochondria Gene Families AT1G15820 77.0 6.8e-113 403.7
Bma12g00374 . 5 256 Chloroplast and Mitochondria Gene Families AT1G15820 75.8 2.6e-112 401.7
Bma12g00392 . 3 254 Chloroplast and Mitochondria Gene Families AT1G15820 75.0 3.7e-111 397.9
Bma12g00859 BCT 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 90.6 1.5e-143 505.8
Bma02g01306 BCT 1 267 Chloroplast and Mitochondria Gene Families AT3G27690 89.9 3.3e-143 504.6
Bma14g00935 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.3 9.5e-119 423.3
Bma14g02131 . 2 264 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 1.6e-118 422.5
Bma01g01496 BCT,CCT 1 229 Chloroplast and Mitochondria Gene Families AT3G27690 84.7 2.1e-118 422.2
Bma14g00933 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 75.2 6.2e-118 420.6
Bma14g00970 BCT,CCT 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 75.2 6.2e-118 420.6
Bma11g00951 CCT 2 264 Chloroplast and Mitochondria Gene Families AT3G27690 73.9 2.0e-116 415.6
Bma11g00950 CCT,ECH 2 264 Chloroplast and Mitochondria Gene Families AT3G27690 74.0 4.4e-116 414.5
Bma10g00936 . 14 232 Chloroplast and Mitochondria Gene Families AT3G27690 86.3 3.7e-115 411.4
Bma14g00934 CCT,ECH 13 231 Chloroplast and Mitochondria Gene Families AT3G27690 86.3 3.7e-115 411.4
Bma14g01769 . 13 231 Chloroplast and Mitochondria Gene Families AT3G27690 85.8 2.1e-113 405.6
Bma14g00298 . 11 268 Chloroplast and Mitochondria Gene Families AT3G27690 67.5 1.7e-99 359.4
Bma14g00969 . 1 160 Chloroplast and Mitochondria Gene Families AT3G27690 86.3 2.1e-81 299.3
Bma07g01333 . 13 222 Chloroplast and Mitochondria Gene Families AT3G27690 60.0 1.2e-68 256.9
Bma06g00979 . 51 272 Chloroplast and Mitochondria Gene Families AT3G27690 51.8 3.3e-55 212.2
Bma01g02461 . 69 274 Chloroplast and Mitochondria Gene Families AT3G27690 53.6 1.0e-51 200.7
Bma01g02471 . 69 274 Chloroplast and Mitochondria Gene Families AT3G27690 53.6 1.0e-51 200.7
Bma10g00275 . 5 270 Chloroplast and Mitochondria Gene Families AT3G61470 77.8 2.6e-125 444.9
Bma04g01474 . 1 207 Chloroplast and Mitochondria Gene Families AT3G61470 86.5 2.5e-115 411.8
Bma10g00226 . 1 156 Chloroplast and Mitochondria Gene Families AT3G61470 91.7 7.5e-88 320.5
Bma12g00994 CCT,ECH 92 276 Chloroplast and Mitochondria Gene Families AT3G61470 56.0 4.7e-58 221.5
Bma03g00334 CCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.8 1.0e-90 329.7
Bma08g00942 CCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.8 1.1e-89 326.2
Bma11g00895 . 1 284 Chloroplast and Mitochondria Gene Families AT3G08940 85.0 3.0e-138 488.0
Bma10g00329 . 1 286 Chloroplast and Mitochondria Gene Families AT3G08940 82.9 1.5e-137 485.7
Bma14g01033 . 1 281 Chloroplast and Mitochondria Gene Families AT3G08940 84.1 3.7e-136 481.1
Bma14g01040 . 2 176 Chloroplast and Mitochondria Gene Families AT3G08940 74.0 1.5e-68 256.5
Bma06g00979 . 1 275 Chloroplast and Mitochondria Gene Families AT1G76570 80.4 1.9e-136 482.3
Bma14g00718 . 1 272 Chloroplast and Mitochondria Gene Families AT1G61520 84.6 1.6e-133 472.2
Bma12g00859 BCT 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.8 1.4e-142 502.3
Bma02g01306 BCT 1 267 Chloroplast and Mitochondria Gene Families AT2G05070 89.1 2.1e-141 498.4
Bma14g00935 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 2.9e-119 424.9
Bma14g02131 . 5 264 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 8.5e-119 423.3
Bma14g00933 . 7 265 Chloroplast and Mitochondria Gene Families AT2G05070 76.9 1.4e-118 422.5
Bma14g00970 BCT,CCT 7 265 Chloroplast and Mitochondria Gene Families AT2G05070 76.9 1.4e-118 422.5
Bma01g01496 BCT,CCT 1 229 Chloroplast and Mitochondria Gene Families AT2G05070 84.7 4.2e-118 421.0
Bma11g00951 CCT 5 264 Chloroplast and Mitochondria Gene Families AT2G05070 75.8 6.1e-117 417.2
Bma11g00950 CCT,ECH 5 264 Chloroplast and Mitochondria Gene Families AT2G05070 75.5 7.9e-117 416.8
Bma10g00936 . 14 232 Chloroplast and Mitochondria Gene Families AT2G05070 86.3 7.4e-115 410.2
Bma14g00934 CCT,ECH 13 231 Chloroplast and Mitochondria Gene Families AT2G05070 86.3 7.4e-115 410.2
Bma14g01769 . 13 231 Chloroplast and Mitochondria Gene Families AT2G05070 85.8 4.1e-113 404.4
Bma14g00298 . 15 268 Chloroplast and Mitochondria Gene Families AT2G05070 69.6 5.7e-99 357.5
Bma14g00969 . 1 160 Chloroplast and Mitochondria Gene Families AT2G05070 86.3 4.1e-81 298.1
Bma07g01333 . 28 222 Chloroplast and Mitochondria Gene Families AT2G05070 61.2 1.4e-68 256.5
Bma06g00979 . 51 275 Chloroplast and Mitochondria Gene Families AT2G05070 50.7 7.3e-54 207.6
Bma01g02461 . 69 274 Chloroplast and Mitochondria Gene Families AT2G05070 54.0 6.8e-52 201.1
Bma01g02471 . 69 274 Chloroplast and Mitochondria Gene Families AT2G05070 54.0 6.8e-52 201.1
Bma12g00859 BCT 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 90.3 1.9e-125 445.7
Bma02g01306 BCT 1 239 Chloroplast and Mitochondria Gene Families AT2G05100 90.0 9.5e-125 443.4
Bma14g00935 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.6 1.6e-100 362.8
Bma14g02131 . 5 236 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 2.8e-100 362.1
Bma01g01496 BCT,CCT 1 201 Chloroplast and Mitochondria Gene Families AT2G05100 83.6 6.2e-100 360.9
Bma14g00933 . 7 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.0 8.1e-100 360.5
Bma14g00970 BCT,CCT 7 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.0 8.1e-100 360.5
Bma11g00951 CCT 5 236 Chloroplast and Mitochondria Gene Families AT2G05100 73.8 3.4e-98 355.1
Bma11g00950 CCT,ECH 5 236 Chloroplast and Mitochondria Gene Families AT2G05100 73.4 4.4e-98 354.8
Bma10g00936 . 14 204 Chloroplast and Mitochondria Gene Families AT2G05100 85.3 1.1e-96 350.1
Bma14g00934 CCT,ECH 13 203 Chloroplast and Mitochondria Gene Families AT2G05100 85.3 1.1e-96 350.1
Bma14g01769 . 13 203 Chloroplast and Mitochondria Gene Families AT2G05100 84.8 6.0e-95 344.4
Bma14g00298 . 12 240 Chloroplast and Mitochondria Gene Families AT2G05100 68.1 1.4e-83 306.6
Bma14g00969 . 1 132 Chloroplast and Mitochondria Gene Families AT2G05100 84.8 6.0e-63 238.0
Bma07g01333 . 28 216 Chloroplast and Mitochondria Gene Families AT2G05100 60.2 6.0e-63 238.0
Bma01g02461 . 69 258 Chloroplast and Mitochondria Gene Families AT2G05100 53.3 8.2e-44 174.5
Bma01g02471 . 69 258 Chloroplast and Mitochondria Gene Families AT2G05100 53.3 8.2e-44 174.5
Bma10g00329 . 1 168 Chloroplast and Mitochondria Gene Families AT2G40100 69.0 5.5e-64 240.7
Bma11g00895 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 68.0 4.6e-63 237.7
Bma14g01033 . 1 164 Chloroplast and Mitochondria Gene Families AT2G40100 68.4 2.3e-62 235.3
Bma14g01040 . 4 166 Chloroplast and Mitochondria Gene Families AT2G40100 68.2 2.5e-61 231.9
Bma14g00935 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 5.3e-137 483.8
Bma14g00933 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 1.0e-135 479.6
Bma14g00970 BCT,CCT 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 1.0e-135 479.6
Bma14g02131 . 1 264 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 5.0e-135 477.2
Bma11g00950 CCT,ECH 1 264 Chloroplast and Mitochondria Gene Families AT1G29930 86.5 7.2e-134 473.4
Bma11g00951 CCT 1 264 Chloroplast and Mitochondria Gene Families AT1G29930 86.5 1.2e-133 472.6
Bma10g00936 . 1 232 Chloroplast and Mitochondria Gene Families AT1G29930 90.1 6.8e-124 440.3
Bma01g01496 BCT,CCT 1 229 Chloroplast and Mitochondria Gene Families AT1G29930 90.1 2.6e-123 438.3
Bma14g00934 CCT,ECH 1 231 Chloroplast and Mitochondria Gene Families AT1G29930 90.1 2.8e-122 434.9
Bma14g01769 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29930 89.7 3.1e-121 431.4
Bma02g01306 BCT 35 267 Chloroplast and Mitochondria Gene Families AT1G29930 83.5 3.0e-116 414.8
Bma12g00859 BCT 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 77.5 5.2e-116 414.1
Bma14g00298 . 50 268 Chloroplast and Mitochondria Gene Families AT1G29930 77.3 1.6e-96 349.4
Bma14g00969 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29930 93.2 1.1e-84 310.1
Bma07g01333 . 50 221 Chloroplast and Mitochondria Gene Families AT1G29930 67.0 2.0e-67 252.7
Bma01g02461 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29930 53.3 3.3e-54 208.8
Bma01g02471 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29930 53.3 3.3e-54 208.8
Bma14g00935 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 2.0e-136 481.9
Bma14g00933 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 3.8e-135 477.6
Bma14g00970 BCT,CCT 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 3.8e-135 477.6
Bma14g02131 . 1 264 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 1.9e-134 475.3
Bma11g00950 CCT,ECH 1 264 Chloroplast and Mitochondria Gene Families AT1G29920 86.1 2.7e-133 471.5
Bma11g00951 CCT 1 264 Chloroplast and Mitochondria Gene Families AT1G29920 86.1 4.7e-133 470.7
Bma10g00936 . 1 232 Chloroplast and Mitochondria Gene Families AT1G29920 90.1 6.8e-124 440.3
Bma01g01496 BCT,CCT 1 229 Chloroplast and Mitochondria Gene Families AT1G29920 90.1 2.6e-123 438.3
Bma14g00934 CCT,ECH 1 231 Chloroplast and Mitochondria Gene Families AT1G29920 90.1 2.8e-122 434.9
Bma14g01769 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29920 89.7 3.1e-121 431.4
Bma02g01306 BCT 35 267 Chloroplast and Mitochondria Gene Families AT1G29920 83.5 3.0e-116 414.8
Bma12g00859 BCT 33 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.5 8.8e-116 413.3
Bma14g00298 . 50 268 Chloroplast and Mitochondria Gene Families AT1G29920 77.3 1.6e-96 349.4
Bma14g00969 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29920 93.2 1.1e-84 310.1
Bma07g01333 . 50 221 Chloroplast and Mitochondria Gene Families AT1G29920 67.0 2.0e-67 252.7
Bma01g02461 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29920 53.3 3.3e-54 208.8
Bma01g02471 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29920 53.3 3.3e-54 208.8
Bma14g00935 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 2.0e-136 481.9
Bma14g00933 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 3.8e-135 477.6
Bma14g00970 BCT,CCT 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 3.8e-135 477.6
Bma14g02131 . 1 264 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 1.9e-134 475.3
Bma11g00950 CCT,ECH 1 264 Chloroplast and Mitochondria Gene Families AT1G29910 86.1 2.7e-133 471.5
Bma11g00951 CCT 1 264 Chloroplast and Mitochondria Gene Families AT1G29910 86.1 4.7e-133 470.7
Bma10g00936 . 1 232 Chloroplast and Mitochondria Gene Families AT1G29910 90.1 6.8e-124 440.3
Bma01g01496 BCT,CCT 1 229 Chloroplast and Mitochondria Gene Families AT1G29910 90.1 2.6e-123 438.3
Bma14g00934 CCT,ECH 1 231 Chloroplast and Mitochondria Gene Families AT1G29910 90.1 2.8e-122 434.9
Bma14g01769 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29910 89.7 3.1e-121 431.4
Bma02g01306 BCT 35 267 Chloroplast and Mitochondria Gene Families AT1G29910 83.5 3.0e-116 414.8
Bma12g00859 BCT 33 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.5 8.8e-116 413.3
Bma14g00298 . 50 268 Chloroplast and Mitochondria Gene Families AT1G29910 77.3 1.6e-96 349.4
Bma14g00969 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29910 93.2 1.1e-84 310.1
Bma07g01333 . 50 221 Chloroplast and Mitochondria Gene Families AT1G29910 67.0 2.0e-67 252.7
Bma01g02461 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29910 53.3 3.3e-54 208.8
Bma01g02471 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29910 53.3 3.3e-54 208.8
Bma01g02461 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 84.6 3.2e-140 494.6
Bma01g02471 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 84.6 3.2e-140 494.6
Bma14g00935 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 7.5e-57 217.6
Bma11g00950 CCT,ECH 48 252 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 9.7e-57 217.2
Bma11g00951 CCT 48 252 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 9.7e-57 217.2
Bma14g01769 . 7 219 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.3e-56 216.9
Bma10g00936 . 16 220 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 1.7e-56 216.5
Bma14g00934 CCT,ECH 15 219 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 1.7e-56 216.5
Bma14g02131 . 49 252 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 1.7e-56 216.5
Bma12g00859 BCT 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 2.2e-56 216.1
Bma02g01306 BCT 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 2.2e-56 216.1
Bma14g00933 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 2.8e-56 215.7
Bma14g00970 BCT,CCT 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 2.8e-56 215.7
Bma01g01496 BCT,CCT 13 217 Chloroplast and Mitochondria Gene Families AT4G10340 51.7 3.7e-56 215.3
Bma14g00298 . 50 256 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 1.6e-51 199.9
Bma14g00969 . 1 148 Chloroplast and Mitochondria Gene Families AT4G10340 52.3 1.7e-37 153.3
Bma14g00935 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.1e-134 476.1
Bma14g00933 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 6.0e-133 470.3
Bma14g00970 BCT,CCT 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 6.0e-133 470.3
Bma14g02131 . 1 264 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 7.9e-133 469.9
Bma11g00950 CCT,ECH 1 264 Chloroplast and Mitochondria Gene Families AT2G34420 86.1 1.0e-132 469.5
Bma11g00951 CCT 1 264 Chloroplast and Mitochondria Gene Families AT2G34420 86.1 1.0e-132 469.5
Bma10g00936 . 1 232 Chloroplast and Mitochondria Gene Families AT2G34420 90.6 3.9e-124 441.0
Bma01g01496 BCT,CCT 1 229 Chloroplast and Mitochondria Gene Families AT2G34420 90.6 1.5e-123 439.1
Bma14g00934 CCT,ECH 1 231 Chloroplast and Mitochondria Gene Families AT2G34420 90.6 1.7e-122 435.6
Bma14g01769 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34420 90.1 1.8e-121 432.2
Bma02g01306 BCT 3 267 Chloroplast and Mitochondria Gene Families AT2G34420 75.5 3.0e-116 414.8
Bma12g00859 BCT 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 75.7 1.1e-115 412.9
Bma14g00298 . 50 268 Chloroplast and Mitochondria Gene Families AT2G34420 77.7 2.0e-96 349.0
Bma14g00969 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34420 93.8 6.1e-85 310.8
Bma07g01333 . 50 221 Chloroplast and Mitochondria Gene Families AT2G34420 67.5 2.6e-67 252.3
Bma01g02461 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34420 53.3 5.6e-54 208.0
Bma01g02471 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34420 53.3 5.6e-54 208.0
Bma14g00935 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 5.0e-135 477.2
Bma14g00933 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.8 5.5e-134 473.8
Bma14g00970 BCT,CCT 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.8 5.5e-134 473.8
Bma14g02131 . 1 264 Chloroplast and Mitochondria Gene Families AT2G34430 86.8 1.2e-133 472.6
Bma11g00950 CCT,ECH 1 264 Chloroplast and Mitochondria Gene Families AT2G34430 86.5 2.1e-133 471.9
Bma11g00951 CCT 1 264 Chloroplast and Mitochondria Gene Families AT2G34430 86.5 3.6e-133 471.1
Bma10g00936 . 1 232 Chloroplast and Mitochondria Gene Families AT2G34430 90.1 1.7e-122 435.6
Bma14g00934 CCT,ECH 1 231 Chloroplast and Mitochondria Gene Families AT2G34430 90.1 6.3e-122 433.7
Bma01g01496 BCT,CCT 1 229 Chloroplast and Mitochondria Gene Families AT2G34430 90.6 1.1e-121 433.0
Bma14g01769 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34430 89.7 3.1e-121 431.4
Bma02g01306 BCT 35 267 Chloroplast and Mitochondria Gene Families AT2G34430 83.5 5.7e-115 410.6
Bma12g00859 BCT 33 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.5 1.7e-114 409.1
Bma14g00298 . 50 268 Chloroplast and Mitochondria Gene Families AT2G34430 77.7 2.7e-96 348.6
Bma14g00969 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34430 93.8 6.2e-85 310.8
Bma07g01333 . 50 221 Chloroplast and Mitochondria Gene Families AT2G34430 67.5 3.4e-67 251.9
Bma01g02461 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34430 53.3 7.3e-54 207.6
Bma01g02471 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34430 53.3 7.3e-54 207.6
Bma10g00329 . 2 286 Chloroplast and Mitochondria Gene Families AT5G01530 82.6 1.1e-138 489.6
Bma11g00895 . 8 284 Chloroplast and Mitochondria Gene Families AT5G01530 84.0 8.4e-136 479.9
Bma14g01033 . 4 281 Chloroplast and Mitochondria Gene Families AT5G01530 83.7 1.1e-135 479.6
Bma14g01040 . 1 176 Chloroplast and Mitochondria Gene Families AT5G01530 71.7 3.3e-68 255.4
Bma01g00945 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 2.8e-143 504.6
Bma01g00945 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.7 1.4e-149 525.8
Bma07g01583 . 4 327 Chloroplast and Mitochondria Gene Families AT2G30160 72.3 4.6e-138 487.6
Bma07g00041 . 5 323 Chloroplast and Mitochondria Gene Families AT2G30160 71.3 9.5e-136 479.9
Bma14g01043 . 4 319 Chloroplast and Mitochondria Gene Families AT2G30160 67.1 1.4e-118 422.9
Bma07g00041 . 2 323 Chloroplast and Mitochondria Gene Families AT1G07030 72.1 1.7e-137 485.7
Bma07g01583 . 4 326 Chloroplast and Mitochondria Gene Families AT1G07030 71.2 9.7e-133 469.9
Bma14g01043 . 10 319 Chloroplast and Mitochondria Gene Families AT1G07030 70.7 1.7e-121 432.6
Bma13g00073 . 1 314 Chloroplast and Mitochondria Gene Families AT2G47490 77.7 6.0e-140 493.8
Bma06g01108 . 466 719 Chloroplast and Mitochondria Gene Families AT2G47490 55.5 4.1e-72 268.5
Bma13g00073 . 16 300 Chloroplast and Mitochondria Gene Families AT1G25380 66.6 8.3e-109 390.6
Bma06g01108 . 466 714 Chloroplast and Mitochondria Gene Families AT1G25380 59.0 1.2e-75 280.4
Bma02g01353 BCT 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 71.2 1.8e-243 838.6
Bma01g00537 . 2 465 Chloroplast and Mitochondria Gene Families AT4G21490 77.4 4.9e-212 734.2
Bma15g00329 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 62.2 2.3e-59 225.3
Bma15g00329 . 4 190 Chloroplast and Mitochondria Gene Families AT3G04800 50.8 6.0e-42 167.5
Bma15g00329 . 6 190 Chloroplast and Mitochondria Gene Families AT1G72750 65.1 1.2e-61 233.0
Bma01g00150 . 7 233 Chloroplast and Mitochondria Gene Families AT1G26100 66.4 4.8e-81 297.7
Bma08g00335 . 23 234 Chloroplast and Mitochondria Gene Families AT4G25570 61.8 4.1e-71 265.0
Bma01g01227 . 7 371 Chloroplast and Mitochondria Gene Families AT5G14040 80.3 6.1e-171 597.0
Bma06g00281 . 12 371 Chloroplast and Mitochondria Gene Families AT5G14040 77.0 3.7e-160 561.2
Bma08g00712 . 10 248 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 1.9e-71 266.5
Bma01g01227 . 8 370 Chloroplast and Mitochondria Gene Families AT3G48850 69.5 4.2e-145 511.1
Bma06g00281 . 11 368 Chloroplast and Mitochondria Gene Families AT3G48850 68.7 2.0e-142 502.3
Bma08g00712 . 10 252 Chloroplast and Mitochondria Gene Families AT3G48850 50.6 2.6e-70 262.7
Bma08g00712 . 6 250 Chloroplast and Mitochondria Gene Families AT2G17270 71.5 6.2e-105 377.5
Bma01g01227 . 70 370 Chloroplast and Mitochondria Gene Families AT2G17270 52.3 1.9e-85 312.8
Bma06g00281 . 70 368 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 3.0e-83 305.4
Bma13g00190 . 5 177 Chloroplast and Mitochondria Gene Families AT5G15640 69.1 2.6e-66 249.2
Bma04g00118 . 12 339 Chloroplast and Mitochondria Gene Families AT5G26200 66.8 8.9e-121 430.3
Bma15g00327 . 1 368 Chloroplast and Mitochondria Gene Families AT5G26200 52.5 1.3e-92 336.7
Bma15g00327 . 1 371 Chloroplast and Mitochondria Gene Families AT1G72820 66.0 5.3e-129 457.6
Bma04g00118 . 1 339 Chloroplast and Mitochondria Gene Families AT1G72820 67.2 3.6e-125 444.9
Bma14g02044 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 62.8 1.1e-71 266.5
Bma14g00601 . 358 447 Chloroplast and Mitochondria Gene Families AT4G25700 80.0 2.3e-40 162.5
Bma07g01335 . 3 258 Chloroplast and Mitochondria Gene Families AT5G54290 84.5 2.2e-114 409.1
Bma01g00348 . 86 514 Chloroplast and Mitochondria Gene Families AT2G18710 88.3 6.9e-216 746.9
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0005095 2 3 0 1 2 1 2 1 1 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 4 2 2 41
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bma01g00945 Bma_Chr01 FPKM 0.0 4.107614 0.0 6.362388 3.963668 3.096708 0.0 6.177988 5.609868 5.520097