Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bma08g00538 ATATACCTGTGTCCAGAGCCTTATCCTGAGGCAAATATGGAGTTTGTCAAGTCTAATGGGATCACTTTGTATCAATTTGGAATTGAAGGCCATAAGGTGTATATTGATGATCATTTCTTCATTCAGGAGCCCTATGTAAACATCCCAGACAAAAAAATTCGCGAGGCACTGAAAGTTATGCTTGACGTCAGGAATCACCCACTTCTAATTCACTGTAACAGAGGAAAGCATCGAACTGGTTGTTTGGTAGGATGCCTGCGTAAAATGCAGAGATGGTGCTTAACATCTGTATTTTCCGAGTACCAGCGGTTTGCAGCCGCTAAAGCTAGAGTTTGTGATCAGAGGTTCATAGAAGTTTTTGATGTTTCTACCTTAAGCCATCTGCCCATTCCTTTTTCTAGCTTTCGACAGTAA 414 41.3 IYLCPEPYPEANMEFVKSNGITLYQFGIEGHKVYIDDHFFIQEPYVNIPDKKIREALKVMLDVRNHPLLIHCNRGKHRTGCLVGCLRKMQRWCLTSVFSEYQRFAAAKARVCDQRFIEVFDVSTLSHLPIPFSSFRQ 137
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
8 31588203 31589869 - Bma027784.1 Bma08g00538 87365

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bma08g00538 137 Gene3D Protein tyrosine phosphatase superfamily 1 124 IPR029021 -
Bma08g00538 137 PRINTS Plant and fungal dual specificity phosphatase signature 2 15 IPR020428 GO:0016791
Bma08g00538 137 PRINTS Plant and fungal dual specificity phosphatase signature 21 35 IPR020428 GO:0016791
Bma08g00538 137 PRINTS Plant and fungal dual specificity phosphatase signature 48 62 IPR020428 GO:0016791
Bma08g00538 137 Pfam Tyrosine phosphatase family 1 126 IPR004861 -
Bma08g00538 137 ProSitePatterns Tyrosine specific protein phosphatases active site. 70 80 IPR016130 GO:0016311|GO:0016791
Bma08g00538 137 PANTHER - 1 134 - -
Bma08g00538 137 PANTHER TYROSINE-PROTEIN PHOSPHATASE 1 134 - -
Bma08g00538 137 SUPERFAMILY (Phosphotyrosine protein) phosphatases II 1 121 IPR029021 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bma08g00538 K18045 SIW14, OCA3; tyrosine-protein phosphatase SIW14 [EC:3.1.3.48] - gmx:100814279 218.394
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bma02g01405 Bma-Chr2:56279284 Bma08g00538 Bma-Chr8:31588203 1.48E-67 dispersed
Bma08g00533 Bma-Chr8:31164361 Bma08g00538 Bma-Chr8:31588203 3.27E-41 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bma08g00514 BCT 42 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.2 5.6e-185 644.4
Bma03g01356 BCT 42 610 Protein tyrosine phosphatase (PTP) family AT3G50110 59.3 2.4e-180 629.0
Bma15g00872 . 42 591 Protein tyrosine phosphatase (PTP) family AT3G50110 59.6 1.9e-177 619.4
Bma02g00437 . 1 411 Protein tyrosine phosphatase (PTP) family AT5G39400 64.0 7.6e-151 530.4
Bma08g01169 . 6 849 Protein tyrosine phosphatase (PTP) family AT3G10550 66.6 0.0e+00 1132.9
Bma08g01169 . 6 851 Protein tyrosine phosphatase (PTP) family AT5G04540 62.9 1.3e-311 1065.4
Bma02g00008 . 1 1289 Protein tyrosine phosphatase (PTP) family AT5G58160 50.4 2.1e-284 975.7
Bma04g00272 . 566 933 Protein tyrosine phosphatase (PTP) family AT5G58160 51.8 1.4e-102 371.7
Bma01g02539 . 23 322 Protein tyrosine phosphatase (PTP) family AT1G71860 65.4 2.3e-116 415.6
Bma04g01172 . 1 129 Protein tyrosine phosphatase (PTP) family AT3G23610 51.9 7.9e-37 150.2
Bma04g01175 . 1 129 Protein tyrosine phosphatase (PTP) family AT3G23610 51.9 7.9e-37 150.2
Bma08g00279 . 2 197 Protein tyrosine phosphatase (PTP) family AT5G23720 61.2 3.1e-59 227.3
Bma04g01172 . 33 170 Protein tyrosine phosphatase (PTP) family AT3G06110 57.2 2.6e-41 165.2
Bma04g01175 . 33 170 Protein tyrosine phosphatase (PTP) family AT3G06110 57.2 2.6e-41 165.2
Bma03g01302 . 1 190 Protein tyrosine phosphatase (PTP) family AT2G04550 67.9 2.5e-66 248.4
Bma03g00369 . 17 294 Protein tyrosine phosphatase (PTP) family AT3G52180 70.5 4.2e-116 414.5
Bma03g00203 . 27 289 Protein tyrosine phosphatase (PTP) family AT3G10940 69.3 1.2e-107 386.3
Bma01g00998 . 137 580 Protein tyrosine phosphatase (PTP) family AT3G01510 71.0 3.6e-194 674.5
Bma01g00978 . 137 580 Protein tyrosine phosphatase (PTP) family AT3G01510 70.4 6.7e-193 670.2
Bma02g01405 . 15 211 Protein tyrosine phosphatase (PTP) family AT2G32960 57.0 1.1e-70 263.5
Bma03g01308 BCT 20 210 Protein tyrosine phosphatase (PTP) family AT2G32960 55.6 1.8e-65 246.1
Bma08g00538 . 1 133 Protein tyrosine phosphatase (PTP) family AT2G32960 59.2 8.1e-50 194.1
Bma02g00600 . 13 160 Protein tyrosine phosphatase (PTP) family AT2G32960 51.1 1.4e-49 193.4
Bma08g00533 BCT 51 152 Protein tyrosine phosphatase (PTP) family AT2G32960 60.3 1.9e-38 156.4
Bma14g00635 . 1 319 Protein tyrosine phosphatase (PTP) family AT2G35680 56.4 6.6e-100 360.9
Bma01g00214 . 6 266 Protein tyrosine phosphatase (PTP) family AT2G35680 52.3 2.4e-78 289.3
Bma02g01405 . 42 211 Protein tyrosine phosphatase (PTP) family AT4G03960 72.4 2.5e-75 278.5
Bma03g01308 BCT 36 210 Protein tyrosine phosphatase (PTP) family AT4G03960 67.4 3.5e-69 258.1
Bma02g00600 . 9 164 Protein tyrosine phosphatase (PTP) family AT4G03960 57.7 3.5e-53 204.9
Bma08g00538 . 1 133 Protein tyrosine phosphatase (PTP) family AT4G03960 66.9 3.7e-50 194.9
Bma08g00533 BCT 30 152 Protein tyrosine phosphatase (PTP) family AT4G03960 60.0 1.3e-39 159.8
Bma02g00600 . 3 199 Protein tyrosine phosphatase (PTP) family AT3G02800 70.1 3.7e-82 301.2
Bma03g01308 BCT 45 202 Protein tyrosine phosphatase (PTP) family AT3G02800 62.0 3.5e-56 214.9
Bma02g01405 . 47 205 Protein tyrosine phosphatase (PTP) family AT3G02800 61.0 7.8e-56 213.8
Bma08g00538 . 1 125 Protein tyrosine phosphatase (PTP) family AT3G02800 57.6 1.9e-38 156.0
Bma03g00116 . 1 187 Protein tyrosine phosphatase (PTP) family AT3G55270 63.0 5.9e-59 226.1
Bma02g00437 . 1 411 Protein tyrosine phosphatase (PTP) family AT5G39400 64.0 7.6e-151 530.4
Bma08g00514 BCT 8 605 Protein tyrosine phosphatase (PTP) family AT3G19420 66.9 1.0e-228 789.6
Bma03g01356 BCT 32 610 Protein tyrosine phosphatase (PTP) family AT3G19420 67.1 5.0e-223 770.8
Bma15g00872 . 34 591 Protein tyrosine phosphatase (PTP) family AT3G19420 57.4 4.0e-188 654.8
Bma08g00514 BCT 42 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.2 5.6e-185 644.4
Bma03g01356 BCT 42 610 Protein tyrosine phosphatase (PTP) family AT3G50110 59.3 2.4e-180 629.0
Bma15g00872 . 42 591 Protein tyrosine phosphatase (PTP) family AT3G50110 59.6 1.9e-177 619.4
Bma02g00008 . 1 1289 Protein tyrosine phosphatase (PTP) family AT5G58160 50.4 2.1e-284 975.7
Bma04g00272 . 566 933 Protein tyrosine phosphatase (PTP) family AT5G58160 51.8 1.4e-102 371.7
Bma08g01169 . 6 849 Protein tyrosine phosphatase (PTP) family AT3G10550 66.6 0.0e+00 1132.9
Bma08g01169 . 6 851 Protein tyrosine phosphatase (PTP) family AT5G04540 62.9 1.3e-311 1065.4
Bma14g00419 . 56 243 Protein tyrosine phosphatase (PTP) family AT3G44620 64.9 2.8e-74 275.4
Bma12g00216 . 19 317 Protein tyrosine phosphatase (PTP) family AT2G35320 62.0 9.8e-111 396.7
Bma10g00319 . 1 661 Protein tyrosine phosphatase (PTP) family AT3G09100 70.5 2.2e-288 988.0
Bma10g00319 . 5 661 Protein tyrosine phosphatase (PTP) family AT5G01290 65.8 5.9e-262 900.2
Bma10g00319 . 87 668 Protein tyrosine phosphatase (PTP) family AT5G28210 57.9 7.7e-187 650.6
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001007 2 3 3 4 3 2 4 2 2 2 2 2 4 2 2 4 2 4 4 1 2 2 2 2 2 2 2 7 6 2 83
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bma08g00538 Bma_Chr08 FPKM 85.061348 93.506561 122.30265 132.567657 31.553968 31.535316 36.377129 200.093826 203.678635 196.941101