Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bma10g00132 ATGAACGACTTGTTCTCTTCCCGGTCTTTCTCCCGCGATCGAACAGGCGTTGAGATGACATATTCGAATTCACCGACCGCCGTCAATCTCGACAAGTTCTTCGAGGACGTTGAGTCGGTGAAGGACGAGCTGAAGGAGCTCGATGATTTGTATACTCGACTGAAACACTCTCACGAGCAGAGCAAGACTCTCCACAACGCAAAGACCGTGAAGGACCTCCGTTCTCGAATGGACTCGGATGTATCGCTCGCTCTCAAGAAAGCGAAGCTCATTAAGGTCCGGTTGGAAGCCTTAGACAGGGCTAATGCTGCTAATAGGAGCTTACCTGGCTGCGGACCCGGATCTTCGTCGGACCGGACCAGAACGTCGGTAGTCAACGGGCTGAGGAAGAAGTTGCAGGACTCTATGGAGAGCTTCAACAATCTGAGACAGGAGATCTCATCGGAATACAGAGATACCGTACAGCGGAGGTACTACACCGTCACCGGAGAAAATCCCGACGAGAAAACCATTGACCTACTGATCTCTACAGGGGAAAGCGAGACATTCTTGCAGAAAGCGATTCAAGAACAAGGAAGAGGCAGAGTTTTGGACACCATTAATGAGATTCAAGAGCGGCACGATGCAGTAAAAGATATGGAGAAGAACCTCAAGGAACTCCACCAGGTTTTCATGGACATGTCCGTGCTGGTGCAGGCTCAAGGAGAGCAACTCGACGACATCGAGAGCCAAATGGCAAGAGCTCATTCGTTCGTCAGAGGCGGAACGCAGGAATTGCATACGGCGAGGGTATATCAGAAAAATACGCGGAAATGGGTGATTATTTCAAGTGTTGTTTTCGTGATTGTCATCATTGTGATTGTTCTCATAATCGTTAGGCCTGGGAGTAAATAG 894 49.44 MNDLFSSRSFSRDRTGVEMTYSNSPTAVNLDKFFEDVESVKDELKELDDLYTRLKHSHEQSKTLHNAKTVKDLRSRMDSDVSLALKKAKLIKVRLEALDRANAANRSLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQEISSEYRDTVQRRYYTVTGENPDEKTIDLLISTGESETFLQKAIQEQGRGRVLDTINEIQERHDAVKDMEKNLKELHQVFMDMSVLVQAQGEQLDDIESQMARAHSFVRGGTQELHTARVYQKNTRKWVIISSVVFVIVIIVIVLIIVRPGSK 297
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
10 1190775 1192115 + Bma003756.1 Bma10g00132 89195

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bma10g00132 297 CDD SynN 30 187 IPR006011 GO:0016020
Bma10g00132 297 CDD SNARE_syntaxin1-like 199 259 - -
Bma10g00132 297 Gene3D - 196 293 - -
Bma10g00132 297 PANTHER BNAA05G27280D PROTEIN 8 290 - -
Bma10g00132 297 Gene3D - 28 160 - -
Bma10g00132 297 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 200 262 IPR000727 -
Bma10g00132 297 Coils Coil 125 149 - -
Bma10g00132 297 SUPERFAMILY t-snare proteins 29 255 IPR010989 GO:0016020|GO:0016192
Bma10g00132 297 ProSitePatterns Syntaxin / epimorphin family signature. 206 245 IPR006012 GO:0005484|GO:0006886|GO:0016020
Bma10g00132 297 Coils Coil 200 220 - -
Bma10g00132 297 Coils Coil 30 57 - -
Bma10g00132 297 PANTHER SYNTAXIN 8 290 IPR045242 -
Bma10g00132 297 Pfam SNARE domain 236 288 IPR000727 -
Bma10g00132 297 SMART tSNARE_6 195 262 IPR000727 -
Bma10g00132 297 Pfam Syntaxin 32 235 IPR006011 GO:0016020
Bma10g00132 297 SMART SynN_4 25 151 IPR006011 GO:0016020
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bma10g00132 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101208931 465.307
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bma07g00353 Bma-Chr7:4463222 Bma10g00132 Bma-Chr10:1190775 3.53E-124 dispersed
Bma10g00132 Bma-Chr10:1190775 Bma11g00374 Bma-Chr11:4077034 3.14E-125 dispersed
Bma01g02014 Bma-Chr1:74718270 Bma10g00132 Bma-Chr10:1190775 1.61E-91 wgd
Bma10g00132 Bma-Chr10:1190775 Bma04g01535 Bma-Chr4:51364686 2.70E-164 wgd
Bma10g00132 Bma-Chr10:1190775 Bma04g00526 Bma-Chr4:4618116 1.11E-151 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bma02g00044 . 444 806 SNARE and Associated Proteins AT3G24350 60.5 7.5e-102 367.5
Bma05g00445 . 1 293 SNARE and Associated Proteins AT2G18260 52.1 1.2e-79 293.5
Bma05g00439 . 1 293 SNARE and Associated Proteins AT2G18260 51.8 5.8e-79 291.2
Bma12g00507 . 1 293 SNARE and Associated Proteins AT2G18260 51.8 4.1e-77 285.0
Bma04g01535 . 1243 1499 SNARE and Associated Proteins AT3G11820 81.7 4.4e-114 407.9
Bma10g00132 . 22 278 SNARE and Associated Proteins AT3G11820 79.8 7.0e-112 400.6
Bma04g00526 . 19 279 SNARE and Associated Proteins AT3G11820 75.1 1.0e-107 386.7
Bma07g00353 . 36 286 SNARE and Associated Proteins AT3G11820 67.3 1.7e-94 342.8
Bma11g00374 . 36 286 SNARE and Associated Proteins AT3G11820 65.7 2.5e-93 339.0
Bma10g00004 . 27 285 SNARE and Associated Proteins AT3G11820 50.2 3.1e-67 252.3
Bma01g02014 . 22 222 SNARE and Associated Proteins AT3G11820 54.8 2.4e-64 242.7
Bma04g01535 . 1250 1499 SNARE and Associated Proteins AT3G52400 70.4 9.6e-91 330.5
Bma04g00526 . 1 279 SNARE and Associated Proteins AT3G52400 61.9 1.5e-88 323.2
Bma10g00132 . 29 272 SNARE and Associated Proteins AT3G52400 68.9 7.6e-88 320.9
Bma07g00353 . 6 286 SNARE and Associated Proteins AT3G52400 57.0 6.2e-82 301.2
Bma11g00374 . 6 286 SNARE and Associated Proteins AT3G52400 55.7 1.2e-80 297.0
Bma11g00374 . 6 304 SNARE and Associated Proteins AT4G03330 66.6 5.0e-107 384.4
Bma07g00353 . 6 304 SNARE and Associated Proteins AT4G03330 67.2 6.6e-107 384.0
Bma04g01535 . 1222 1499 SNARE and Associated Proteins AT4G03330 56.0 9.5e-82 300.4
Bma10g00132 . 29 278 SNARE and Associated Proteins AT4G03330 58.8 8.1e-81 297.4
Bma04g00526 . 1 279 SNARE and Associated Proteins AT4G03330 55.4 4.9e-78 288.1
Bma10g00004 . 1 285 SNARE and Associated Proteins AT4G03330 50.2 5.6e-66 248.1
Bma11g00374 . 6 304 SNARE and Associated Proteins AT1G61290 78.3 6.9e-125 443.7
Bma07g00353 . 6 308 SNARE and Associated Proteins AT1G61290 77.9 7.7e-124 440.3
Bma04g01535 . 1222 1493 SNARE and Associated Proteins AT1G61290 62.9 2.7e-89 325.5
Bma10g00132 . 1 281 SNARE and Associated Proteins AT1G61290 58.8 1.7e-86 316.2
Bma04g00526 . 1 279 SNARE and Associated Proteins AT1G61290 59.4 5.4e-85 311.2
Bma07g00353 . 6 308 SNARE and Associated Proteins AT1G11250 76.6 1.3e-120 429.5
Bma11g00374 . 6 304 SNARE and Associated Proteins AT1G11250 75.9 3.0e-120 428.3
Bma04g01535 . 1222 1493 SNARE and Associated Proteins AT1G11250 64.3 1.8e-93 339.3
Bma10g00132 . 1 281 SNARE and Associated Proteins AT1G11250 60.1 6.4e-91 330.9
Bma04g00526 . 1 279 SNARE and Associated Proteins AT1G11250 61.3 4.6e-89 324.7
Bma10g00004 . 1 306 SNARE and Associated Proteins AT3G03800 76.5 1.2e-116 416.4
Bma10g00004 . 1 204 SNARE and Associated Proteins AT5G08080 75.5 6.1e-78 287.3
Bma12g00235 BCT 1 263 SNARE and Associated Proteins AT5G16830 62.8 6.5e-77 284.3
Bma05g00704 BCT 1 148 SNARE and Associated Proteins AT5G16830 58.4 3.1e-39 159.1
Bma12g00235 BCT 1 263 SNARE and Associated Proteins AT5G46860 70.7 2.0e-83 305.8
Bma05g00704 BCT 1 153 SNARE and Associated Proteins AT5G46860 75.8 2.5e-57 219.2
Bma12g00235 BCT 1 257 SNARE and Associated Proteins AT4G17730 64.2 9.7e-75 276.9
Bma05g00704 BCT 1 148 SNARE and Associated Proteins AT4G17730 72.2 8.0e-53 204.1
Bma06g00441 . 1 182 SNARE and Associated Proteins AT4G17730 54.1 1.2e-43 173.7
Bma12g00235 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 1.8e-49 193.4
Bma03g00258 . 1 325 SNARE and Associated Proteins AT5G05760 65.4 3.5e-109 391.7
Bma02g00044 . 444 806 SNARE and Associated Proteins AT3G24350 60.5 7.5e-102 367.5
Bma01g00625 . 1 341 SNARE and Associated Proteins AT5G26980 75.4 2.5e-125 445.3
Bma05g00265 . 1 339 SNARE and Associated Proteins AT5G26980 74.0 9.0e-123 436.8
Bma01g00625 . 1 339 SNARE and Associated Proteins AT4G02195 63.9 2.6e-101 365.5
Bma05g00265 . 1 337 SNARE and Associated Proteins AT4G02195 63.4 3.7e-100 361.7
Bma01g00625 . 1 339 SNARE and Associated Proteins AT3G05710 75.2 4.7e-127 451.1
Bma05g00265 . 1 337 SNARE and Associated Proteins AT3G05710 75.4 6.2e-127 450.7
Bma07g01281 BCT 1 232 SNARE and Associated Proteins AT1G16240 65.4 7.0e-77 283.9
Bma10g00582 . 1 230 SNARE and Associated Proteins AT1G16240 58.4 4.9e-70 261.2
Bma14g00320 BCT 1 232 SNARE and Associated Proteins AT1G16240 57.6 2.3e-64 242.3
Bma07g01281 BCT 1 232 SNARE and Associated Proteins AT1G79590 65.0 1.9e-78 289.3
Bma10g00582 . 1 230 SNARE and Associated Proteins AT1G79590 59.4 6.1e-69 257.7
Bma14g00320 BCT 1 232 SNARE and Associated Proteins AT1G79590 59.6 6.8e-68 254.2
Bma07g01292 . 86 281 SNARE and Associated Proteins AT1G28490 68.4 1.3e-66 249.6
Bma07g01329 . 86 281 SNARE and Associated Proteins AT1G28490 66.3 5.9e-64 240.7
Bma14g00333 . 55 235 SNARE and Associated Proteins AT1G28490 65.2 5.7e-59 224.2
Bma11g00164 . 1 286 SNARE and Associated Proteins AT3G09740 56.1 6.0e-80 294.3
Bma11g00164 . 1 286 SNARE and Associated Proteins AT3G45280 55.7 2.1e-77 285.8
Bma11g00164 . 1 286 SNARE and Associated Proteins AT3G61450 52.3 4.8e-74 274.6
Bma03g00162 . 33 278 SNARE and Associated Proteins AT1G51740 71.2 7.7e-90 327.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bma10g00132 Bma_Chr10 FPKM 0.360587 0.440462 0.309257 0.334738 0.146432 0.11086 0.0 0.714744 0.564125 0.807595