Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Bma11g00950	ATGGCTGCTTCCACCATGGCTCTTTCTTCTCCTTCACTCGCCGGAAAGGCTGTGAAGTTTTCCCCCTCCGCTTCCGAGGTTGTCGGAAATGGAAGAGTCAGCATGAGGAAAACTGGCGGAAAGCCTTCTTCCGGCAGCCCGTGGTACGGTCCCGACAGAGTCAAGTATCTGGGTCCATTCTCCGGCTCCCCTCCCTCCTACCTCACTGGTGAATTCCCCGGTGACTACGGGTGGGACACTGCTGGACTCTCCGCCGACCCGGAGACCTTCGCCAAGAACAGAGAACTCGAAGTAATCCACGCCAGATGGGCCATGCTCGGCACTCTCGGATGCGTCTTCCCAGAACTCCTCTCCCGAAACGGAGTCCAGTTCGGCGAAGCTATCTGGTTCAAAGCCGGATCCCAGATTTTCCAAGAGGGAGGGCTTAACTACTTGGGCAACCCAAGCTTGGTTCACGCTCAGAGCATCCTCGCAATATGGGCCTCTCAGGTCATCTTGATGGGCGCCGTCGAGGGTTACCGTATTGCCGGTGGACCACTCGGAGATGTCACCGACCCGATCTACCCAGGTGGAAGCTTCGACCCATTGGGTCTCGCCGACGACCCAGAAGCATTCGCAGAGCTGAAAGTGAAGGAGCTCAAGAACGGAAGGCTGGCTATGTTTTCTATGTTCGGGTTCTACGTGCAAGCGATTGTCACCGGAAAAGGTCCGTTGGAGAACCTCGCAGACCACCTCGCCGACCCTGTTAACAACAACGCTTGGGCATATGCCACCAACTTTGTCCCCGGGAAATAA	795	56.6	MAASTMALSSPSLAGKAVKFSPSASEVVGNGRVSMRKTGGKPSSGSPWYGPDRVKYLGPFSGSPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGTLGCVFPELLSRNGVQFGEAIWFKAGSQIFQEGGLNYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGGPLGDVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFYVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK	264

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
11	42441085	42441879	-	Bma006741.1	Bma11g00950	91352

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Bma11g00950	264	PANTHER	CHLOROPHYLL A/B BINDING PROTEIN	1	264	IPR001344	GO:0009765\|GO:0016020
Bma11g00950	264	SUPERFAMILY	Chlorophyll a-b binding protein	47	261	-	-
Bma11g00950	264	Gene3D	Chlorophyll a/b binding protein domain	55	257	-	-
Bma11g00950	264	Pfam	Chlorophyll A-B binding protein	64	230	IPR022796	-
Bma11g00950	264	PANTHER	CHLOROPHYLL A-B BINDING PROTEIN 3, CHLOROPLASTIC	1	264	-	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Bma11g00950	K08912	LHCB1; light-harvesting complex II chlorophyll a/b binding protein 1	-	cpap:110819729	507.294

WGDs- Genes

Select	Gene_1	Gene_2	Event_name
	Bma11g00950	Bma14g00934	CCT
	Bma11g00950	Bma14g00934	ECH

Dupl-types

Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
Bma11g00950	Bma-Chr11:42441085	Bma14g00935	Bma-Chr14:10678062	0	dispersed
Bma11g00950	Bma-Chr11:42441085	Bma11g00951	Bma-Chr11:42443230	0	tandem
Bma01g01496	Bma-Chr1:29519144	Bma11g00950	Bma-Chr11:42441085	1.02E-159	wgd

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi10g366	.	.	.	.	.	.	Bma14g00934	.	.	.	Cma03g01381	Cma07g00128	.	.	Sed01g2226	.	.	Bhi03g00050	Tan03g2668	Cmetu12g1325	.	.	.	.	Cla01g02380	Cam01g2495	Cec04g2143	Cco04g2219	Clacu01g2514	Cmu01g2380	Cre04g2049	.	.	.	.	Lsi01g00172	Csa06g03767	.	Cme08g00160	.	Blo14g00842	.	Bda07g00940	.	.	.	Bma11g00950	.	Cmo03g01376	Cmo07g00129	.	.	.	.	Cpe19g01123	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	Chy02g00166	.

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Bma07g01536	.	1	482	Chloroplast and Mitochondria Gene Families	AT2G28800	56.5	8.1e-135	477.2
Bma06g00591	.	57	426	Chloroplast and Mitochondria Gene Families	AT2G28800	54.1	7.9e-98	354.4
Bma05g00575	.	3	254	Chloroplast and Mitochondria Gene Families	AT1G15820	77.0	6.8e-113	403.7
Bma12g00374	.	5	256	Chloroplast and Mitochondria Gene Families	AT1G15820	75.8	2.6e-112	401.7
Bma12g00392	.	3	254	Chloroplast and Mitochondria Gene Families	AT1G15820	75.0	3.7e-111	397.9
Bma12g00859	BCT	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	90.6	1.5e-143	505.8
Bma02g01306	BCT	1	267	Chloroplast and Mitochondria Gene Families	AT3G27690	89.9	3.3e-143	504.6
Bma14g00935	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	76.3	9.5e-119	423.3
Bma14g02131	.	2	264	Chloroplast and Mitochondria Gene Families	AT3G27690	76.7	1.6e-118	422.5
Bma01g01496	BCT,CCT	1	229	Chloroplast and Mitochondria Gene Families	AT3G27690	84.7	2.1e-118	422.2
Bma14g00933	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	75.2	6.2e-118	420.6
Bma14g00970	BCT,CCT	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	75.2	6.2e-118	420.6
Bma11g00951	CCT	2	264	Chloroplast and Mitochondria Gene Families	AT3G27690	73.9	2.0e-116	415.6
Bma11g00950	CCT,ECH	2	264	Chloroplast and Mitochondria Gene Families	AT3G27690	74.0	4.4e-116	414.5
Bma10g00936	.	14	232	Chloroplast and Mitochondria Gene Families	AT3G27690	86.3	3.7e-115	411.4
Bma14g00934	CCT,ECH	13	231	Chloroplast and Mitochondria Gene Families	AT3G27690	86.3	3.7e-115	411.4
Bma14g01769	.	13	231	Chloroplast and Mitochondria Gene Families	AT3G27690	85.8	2.1e-113	405.6
Bma14g00298	.	11	268	Chloroplast and Mitochondria Gene Families	AT3G27690	67.5	1.7e-99	359.4
Bma14g00969	.	1	160	Chloroplast and Mitochondria Gene Families	AT3G27690	86.3	2.1e-81	299.3
Bma07g01333	.	13	222	Chloroplast and Mitochondria Gene Families	AT3G27690	60.0	1.2e-68	256.9
Bma06g00979	.	51	272	Chloroplast and Mitochondria Gene Families	AT3G27690	51.8	3.3e-55	212.2
Bma01g02461	.	69	274	Chloroplast and Mitochondria Gene Families	AT3G27690	53.6	1.0e-51	200.7
Bma01g02471	.	69	274	Chloroplast and Mitochondria Gene Families	AT3G27690	53.6	1.0e-51	200.7
Bma10g00275	.	5	270	Chloroplast and Mitochondria Gene Families	AT3G61470	77.8	2.6e-125	444.9
Bma04g01474	.	1	207	Chloroplast and Mitochondria Gene Families	AT3G61470	86.5	2.5e-115	411.8
Bma10g00226	.	1	156	Chloroplast and Mitochondria Gene Families	AT3G61470	91.7	7.5e-88	320.5
Bma12g00994	CCT,ECH	92	276	Chloroplast and Mitochondria Gene Families	AT3G61470	56.0	4.7e-58	221.5
Bma03g00334	CCT	1	198	Chloroplast and Mitochondria Gene Families	AT3G54890	80.8	1.0e-90	329.7
Bma08g00942	CCT	1	198	Chloroplast and Mitochondria Gene Families	AT3G54890	80.8	1.1e-89	326.2
Bma11g00895	.	1	284	Chloroplast and Mitochondria Gene Families	AT3G08940	85.0	3.0e-138	488.0
Bma10g00329	.	1	286	Chloroplast and Mitochondria Gene Families	AT3G08940	82.9	1.5e-137	485.7
Bma14g01033	.	1	281	Chloroplast and Mitochondria Gene Families	AT3G08940	84.1	3.7e-136	481.1
Bma14g01040	.	2	176	Chloroplast and Mitochondria Gene Families	AT3G08940	74.0	1.5e-68	256.5
Bma06g00979	.	1	275	Chloroplast and Mitochondria Gene Families	AT1G76570	80.4	1.9e-136	482.3
Bma14g00718	.	1	272	Chloroplast and Mitochondria Gene Families	AT1G61520	84.6	1.6e-133	472.2
Bma12g00859	BCT	1	265	Chloroplast and Mitochondria Gene Families	AT2G05070	89.8	1.4e-142	502.3
Bma02g01306	BCT	1	267	Chloroplast and Mitochondria Gene Families	AT2G05070	89.1	2.1e-141	498.4
Bma14g00935	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	77.4	2.9e-119	424.9
Bma14g02131	.	5	264	Chloroplast and Mitochondria Gene Families	AT2G05070	77.8	8.5e-119	423.3
Bma14g00933	.	7	265	Chloroplast and Mitochondria Gene Families	AT2G05070	76.9	1.4e-118	422.5
Bma14g00970	BCT,CCT	7	265	Chloroplast and Mitochondria Gene Families	AT2G05070	76.9	1.4e-118	422.5
Bma01g01496	BCT,CCT	1	229	Chloroplast and Mitochondria Gene Families	AT2G05070	84.7	4.2e-118	421.0
Bma11g00951	CCT	5	264	Chloroplast and Mitochondria Gene Families	AT2G05070	75.8	6.1e-117	417.2
Bma11g00950	CCT,ECH	5	264	Chloroplast and Mitochondria Gene Families	AT2G05070	75.5	7.9e-117	416.8
Bma10g00936	.	14	232	Chloroplast and Mitochondria Gene Families	AT2G05070	86.3	7.4e-115	410.2
Bma14g00934	CCT,ECH	13	231	Chloroplast and Mitochondria Gene Families	AT2G05070	86.3	7.4e-115	410.2
Bma14g01769	.	13	231	Chloroplast and Mitochondria Gene Families	AT2G05070	85.8	4.1e-113	404.4
Bma14g00298	.	15	268	Chloroplast and Mitochondria Gene Families	AT2G05070	69.6	5.7e-99	357.5
Bma14g00969	.	1	160	Chloroplast and Mitochondria Gene Families	AT2G05070	86.3	4.1e-81	298.1
Bma07g01333	.	28	222	Chloroplast and Mitochondria Gene Families	AT2G05070	61.2	1.4e-68	256.5
Bma06g00979	.	51	275	Chloroplast and Mitochondria Gene Families	AT2G05070	50.7	7.3e-54	207.6
Bma01g02461	.	69	274	Chloroplast and Mitochondria Gene Families	AT2G05070	54.0	6.8e-52	201.1
Bma01g02471	.	69	274	Chloroplast and Mitochondria Gene Families	AT2G05070	54.0	6.8e-52	201.1
Bma12g00859	BCT	1	237	Chloroplast and Mitochondria Gene Families	AT2G05100	90.3	1.9e-125	445.7
Bma02g01306	BCT	1	239	Chloroplast and Mitochondria Gene Families	AT2G05100	90.0	9.5e-125	443.4
Bma14g00935	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.6	1.6e-100	362.8
Bma14g02131	.	5	236	Chloroplast and Mitochondria Gene Families	AT2G05100	76.1	2.8e-100	362.1
Bma01g01496	BCT,CCT	1	201	Chloroplast and Mitochondria Gene Families	AT2G05100	83.6	6.2e-100	360.9
Bma14g00933	.	7	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.0	8.1e-100	360.5
Bma14g00970	BCT,CCT	7	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.0	8.1e-100	360.5
Bma11g00951	CCT	5	236	Chloroplast and Mitochondria Gene Families	AT2G05100	73.8	3.4e-98	355.1
Bma11g00950	CCT,ECH	5	236	Chloroplast and Mitochondria Gene Families	AT2G05100	73.4	4.4e-98	354.8
Bma10g00936	.	14	204	Chloroplast and Mitochondria Gene Families	AT2G05100	85.3	1.1e-96	350.1
Bma14g00934	CCT,ECH	13	203	Chloroplast and Mitochondria Gene Families	AT2G05100	85.3	1.1e-96	350.1
Bma14g01769	.	13	203	Chloroplast and Mitochondria Gene Families	AT2G05100	84.8	6.0e-95	344.4
Bma14g00298	.	12	240	Chloroplast and Mitochondria Gene Families	AT2G05100	68.1	1.4e-83	306.6
Bma14g00969	.	1	132	Chloroplast and Mitochondria Gene Families	AT2G05100	84.8	6.0e-63	238.0
Bma07g01333	.	28	216	Chloroplast and Mitochondria Gene Families	AT2G05100	60.2	6.0e-63	238.0
Bma01g02461	.	69	258	Chloroplast and Mitochondria Gene Families	AT2G05100	53.3	8.2e-44	174.5
Bma01g02471	.	69	258	Chloroplast and Mitochondria Gene Families	AT2G05100	53.3	8.2e-44	174.5
Bma10g00329	.	1	168	Chloroplast and Mitochondria Gene Families	AT2G40100	69.0	5.5e-64	240.7
Bma11g00895	.	3	167	Chloroplast and Mitochondria Gene Families	AT2G40100	68.0	4.6e-63	237.7
Bma14g01033	.	1	164	Chloroplast and Mitochondria Gene Families	AT2G40100	68.4	2.3e-62	235.3
Bma14g01040	.	4	166	Chloroplast and Mitochondria Gene Families	AT2G40100	68.2	2.5e-61	231.9
Bma14g00935	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	89.1	5.3e-137	483.8
Bma14g00933	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.0	1.0e-135	479.6
Bma14g00970	BCT,CCT	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.0	1.0e-135	479.6
Bma14g02131	.	1	264	Chloroplast and Mitochondria Gene Families	AT1G29930	88.0	5.0e-135	477.2
Bma11g00950	CCT,ECH	1	264	Chloroplast and Mitochondria Gene Families	AT1G29930	86.5	7.2e-134	473.4
Bma11g00951	CCT	1	264	Chloroplast and Mitochondria Gene Families	AT1G29930	86.5	1.2e-133	472.6
Bma10g00936	.	1	232	Chloroplast and Mitochondria Gene Families	AT1G29930	90.1	6.8e-124	440.3
Bma01g01496	BCT,CCT	1	229	Chloroplast and Mitochondria Gene Families	AT1G29930	90.1	2.6e-123	438.3
Bma14g00934	CCT,ECH	1	231	Chloroplast and Mitochondria Gene Families	AT1G29930	90.1	2.8e-122	434.9
Bma14g01769	.	1	231	Chloroplast and Mitochondria Gene Families	AT1G29930	89.7	3.1e-121	431.4
Bma02g01306	BCT	35	267	Chloroplast and Mitochondria Gene Families	AT1G29930	83.5	3.0e-116	414.8
Bma12g00859	BCT	3	265	Chloroplast and Mitochondria Gene Families	AT1G29930	77.5	5.2e-116	414.1
Bma14g00298	.	50	268	Chloroplast and Mitochondria Gene Families	AT1G29930	77.3	1.6e-96	349.4
Bma14g00969	.	1	160	Chloroplast and Mitochondria Gene Families	AT1G29930	93.2	1.1e-84	310.1
Bma07g01333	.	50	221	Chloroplast and Mitochondria Gene Families	AT1G29930	67.0	2.0e-67	252.7
Bma01g02461	.	69	274	Chloroplast and Mitochondria Gene Families	AT1G29930	53.3	3.3e-54	208.8
Bma01g02471	.	69	274	Chloroplast and Mitochondria Gene Families	AT1G29930	53.3	3.3e-54	208.8
Bma14g00935	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	88.8	2.0e-136	481.9
Bma14g00933	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.6	3.8e-135	477.6
Bma14g00970	BCT,CCT	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.6	3.8e-135	477.6
Bma14g02131	.	1	264	Chloroplast and Mitochondria Gene Families	AT1G29920	87.6	1.9e-134	475.3
Bma11g00950	CCT,ECH	1	264	Chloroplast and Mitochondria Gene Families	AT1G29920	86.1	2.7e-133	471.5
Bma11g00951	CCT	1	264	Chloroplast and Mitochondria Gene Families	AT1G29920	86.1	4.7e-133	470.7
Bma10g00936	.	1	232	Chloroplast and Mitochondria Gene Families	AT1G29920	90.1	6.8e-124	440.3
Bma01g01496	BCT,CCT	1	229	Chloroplast and Mitochondria Gene Families	AT1G29920	90.1	2.6e-123	438.3
Bma14g00934	CCT,ECH	1	231	Chloroplast and Mitochondria Gene Families	AT1G29920	90.1	2.8e-122	434.9
Bma14g01769	.	1	231	Chloroplast and Mitochondria Gene Families	AT1G29920	89.7	3.1e-121	431.4
Bma02g01306	BCT	35	267	Chloroplast and Mitochondria Gene Families	AT1G29920	83.5	3.0e-116	414.8
Bma12g00859	BCT	33	265	Chloroplast and Mitochondria Gene Families	AT1G29920	83.5	8.8e-116	413.3
Bma14g00298	.	50	268	Chloroplast and Mitochondria Gene Families	AT1G29920	77.3	1.6e-96	349.4
Bma14g00969	.	1	160	Chloroplast and Mitochondria Gene Families	AT1G29920	93.2	1.1e-84	310.1
Bma07g01333	.	50	221	Chloroplast and Mitochondria Gene Families	AT1G29920	67.0	2.0e-67	252.7
Bma01g02461	.	69	274	Chloroplast and Mitochondria Gene Families	AT1G29920	53.3	3.3e-54	208.8
Bma01g02471	.	69	274	Chloroplast and Mitochondria Gene Families	AT1G29920	53.3	3.3e-54	208.8
Bma14g00935	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	88.8	2.0e-136	481.9
Bma14g00933	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.6	3.8e-135	477.6
Bma14g00970	BCT,CCT	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.6	3.8e-135	477.6
Bma14g02131	.	1	264	Chloroplast and Mitochondria Gene Families	AT1G29910	87.6	1.9e-134	475.3
Bma11g00950	CCT,ECH	1	264	Chloroplast and Mitochondria Gene Families	AT1G29910	86.1	2.7e-133	471.5
Bma11g00951	CCT	1	264	Chloroplast and Mitochondria Gene Families	AT1G29910	86.1	4.7e-133	470.7
Bma10g00936	.	1	232	Chloroplast and Mitochondria Gene Families	AT1G29910	90.1	6.8e-124	440.3
Bma01g01496	BCT,CCT	1	229	Chloroplast and Mitochondria Gene Families	AT1G29910	90.1	2.6e-123	438.3
Bma14g00934	CCT,ECH	1	231	Chloroplast and Mitochondria Gene Families	AT1G29910	90.1	2.8e-122	434.9
Bma14g01769	.	1	231	Chloroplast and Mitochondria Gene Families	AT1G29910	89.7	3.1e-121	431.4
Bma02g01306	BCT	35	267	Chloroplast and Mitochondria Gene Families	AT1G29910	83.5	3.0e-116	414.8
Bma12g00859	BCT	33	265	Chloroplast and Mitochondria Gene Families	AT1G29910	83.5	8.8e-116	413.3
Bma14g00298	.	50	268	Chloroplast and Mitochondria Gene Families	AT1G29910	77.3	1.6e-96	349.4
Bma14g00969	.	1	160	Chloroplast and Mitochondria Gene Families	AT1G29910	93.2	1.1e-84	310.1
Bma07g01333	.	50	221	Chloroplast and Mitochondria Gene Families	AT1G29910	67.0	2.0e-67	252.7
Bma01g02461	.	69	274	Chloroplast and Mitochondria Gene Families	AT1G29910	53.3	3.3e-54	208.8
Bma01g02471	.	69	274	Chloroplast and Mitochondria Gene Families	AT1G29910	53.3	3.3e-54	208.8
Bma01g02461	.	11	289	Chloroplast and Mitochondria Gene Families	AT4G10340	84.6	3.2e-140	494.6
Bma01g02471	.	11	289	Chloroplast and Mitochondria Gene Families	AT4G10340	84.6	3.2e-140	494.6
Bma14g00935	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	7.5e-57	217.6
Bma11g00950	CCT,ECH	48	252	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	9.7e-57	217.2
Bma11g00951	CCT	48	252	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	9.7e-57	217.2
Bma14g01769	.	7	219	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	1.3e-56	216.9
Bma10g00936	.	16	220	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	1.7e-56	216.5
Bma14g00934	CCT,ECH	15	219	Chloroplast and Mitochondria Gene Families	AT4G10340	52.6	1.7e-56	216.5
Bma14g02131	.	49	252	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	1.7e-56	216.5
Bma12g00859	BCT	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	2.2e-56	216.1
Bma02g01306	BCT	51	255	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	2.2e-56	216.1
Bma14g00933	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.2	2.8e-56	215.7
Bma14g00970	BCT,CCT	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.2	2.8e-56	215.7
Bma01g01496	BCT,CCT	13	217	Chloroplast and Mitochondria Gene Families	AT4G10340	51.7	3.7e-56	215.3
Bma14g00298	.	50	256	Chloroplast and Mitochondria Gene Families	AT4G10340	52.6	1.6e-51	199.9
Bma14g00969	.	1	148	Chloroplast and Mitochondria Gene Families	AT4G10340	52.3	1.7e-37	153.3
Bma14g00935	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	88.4	1.1e-134	476.1
Bma14g00933	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	86.9	6.0e-133	470.3
Bma14g00970	BCT,CCT	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	86.9	6.0e-133	470.3
Bma14g02131	.	1	264	Chloroplast and Mitochondria Gene Families	AT2G34420	87.6	7.9e-133	469.9
Bma11g00950	CCT,ECH	1	264	Chloroplast and Mitochondria Gene Families	AT2G34420	86.1	1.0e-132	469.5
Bma11g00951	CCT	1	264	Chloroplast and Mitochondria Gene Families	AT2G34420	86.1	1.0e-132	469.5
Bma10g00936	.	1	232	Chloroplast and Mitochondria Gene Families	AT2G34420	90.6	3.9e-124	441.0
Bma01g01496	BCT,CCT	1	229	Chloroplast and Mitochondria Gene Families	AT2G34420	90.6	1.5e-123	439.1
Bma14g00934	CCT,ECH	1	231	Chloroplast and Mitochondria Gene Families	AT2G34420	90.6	1.7e-122	435.6
Bma14g01769	.	1	231	Chloroplast and Mitochondria Gene Families	AT2G34420	90.1	1.8e-121	432.2
Bma02g01306	BCT	3	267	Chloroplast and Mitochondria Gene Families	AT2G34420	75.5	3.0e-116	414.8
Bma12g00859	BCT	3	265	Chloroplast and Mitochondria Gene Families	AT2G34420	75.7	1.1e-115	412.9
Bma14g00298	.	50	268	Chloroplast and Mitochondria Gene Families	AT2G34420	77.7	2.0e-96	349.0
Bma14g00969	.	1	160	Chloroplast and Mitochondria Gene Families	AT2G34420	93.8	6.1e-85	310.8
Bma07g01333	.	50	221	Chloroplast and Mitochondria Gene Families	AT2G34420	67.5	2.6e-67	252.3
Bma01g02461	.	69	274	Chloroplast and Mitochondria Gene Families	AT2G34420	53.3	5.6e-54	208.0
Bma01g02471	.	69	274	Chloroplast and Mitochondria Gene Families	AT2G34420	53.3	5.6e-54	208.0
Bma14g00935	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	5.0e-135	477.2
Bma14g00933	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	86.8	5.5e-134	473.8
Bma14g00970	BCT,CCT	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	86.8	5.5e-134	473.8
Bma14g02131	.	1	264	Chloroplast and Mitochondria Gene Families	AT2G34430	86.8	1.2e-133	472.6
Bma11g00950	CCT,ECH	1	264	Chloroplast and Mitochondria Gene Families	AT2G34430	86.5	2.1e-133	471.9
Bma11g00951	CCT	1	264	Chloroplast and Mitochondria Gene Families	AT2G34430	86.5	3.6e-133	471.1
Bma10g00936	.	1	232	Chloroplast and Mitochondria Gene Families	AT2G34430	90.1	1.7e-122	435.6
Bma14g00934	CCT,ECH	1	231	Chloroplast and Mitochondria Gene Families	AT2G34430	90.1	6.3e-122	433.7
Bma01g01496	BCT,CCT	1	229	Chloroplast and Mitochondria Gene Families	AT2G34430	90.6	1.1e-121	433.0
Bma14g01769	.	1	231	Chloroplast and Mitochondria Gene Families	AT2G34430	89.7	3.1e-121	431.4
Bma02g01306	BCT	35	267	Chloroplast and Mitochondria Gene Families	AT2G34430	83.5	5.7e-115	410.6
Bma12g00859	BCT	33	265	Chloroplast and Mitochondria Gene Families	AT2G34430	83.5	1.7e-114	409.1
Bma14g00298	.	50	268	Chloroplast and Mitochondria Gene Families	AT2G34430	77.7	2.7e-96	348.6
Bma14g00969	.	1	160	Chloroplast and Mitochondria Gene Families	AT2G34430	93.8	6.2e-85	310.8
Bma07g01333	.	50	221	Chloroplast and Mitochondria Gene Families	AT2G34430	67.5	3.4e-67	251.9
Bma01g02461	.	69	274	Chloroplast and Mitochondria Gene Families	AT2G34430	53.3	7.3e-54	207.6
Bma01g02471	.	69	274	Chloroplast and Mitochondria Gene Families	AT2G34430	53.3	7.3e-54	207.6
Bma10g00329	.	2	286	Chloroplast and Mitochondria Gene Families	AT5G01530	82.6	1.1e-138	489.6
Bma11g00895	.	8	284	Chloroplast and Mitochondria Gene Families	AT5G01530	84.0	8.4e-136	479.9
Bma14g01033	.	4	281	Chloroplast and Mitochondria Gene Families	AT5G01530	83.7	1.1e-135	479.6
Bma14g01040	.	1	176	Chloroplast and Mitochondria Gene Families	AT5G01530	71.7	3.3e-68	255.4
Bma01g00945	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	93.5	2.8e-143	504.6
Bma01g00945	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	84.7	1.4e-149	525.8
Bma07g01583	.	4	327	Chloroplast and Mitochondria Gene Families	AT2G30160	72.3	4.6e-138	487.6
Bma07g00041	.	5	323	Chloroplast and Mitochondria Gene Families	AT2G30160	71.3	9.5e-136	479.9
Bma14g01043	.	4	319	Chloroplast and Mitochondria Gene Families	AT2G30160	67.1	1.4e-118	422.9
Bma07g00041	.	2	323	Chloroplast and Mitochondria Gene Families	AT1G07030	72.1	1.7e-137	485.7
Bma07g01583	.	4	326	Chloroplast and Mitochondria Gene Families	AT1G07030	71.2	9.7e-133	469.9
Bma14g01043	.	10	319	Chloroplast and Mitochondria Gene Families	AT1G07030	70.7	1.7e-121	432.6
Bma13g00073	.	1	314	Chloroplast and Mitochondria Gene Families	AT2G47490	77.7	6.0e-140	493.8
Bma06g01108	.	466	719	Chloroplast and Mitochondria Gene Families	AT2G47490	55.5	4.1e-72	268.5
Bma13g00073	.	16	300	Chloroplast and Mitochondria Gene Families	AT1G25380	66.6	8.3e-109	390.6
Bma06g01108	.	466	714	Chloroplast and Mitochondria Gene Families	AT1G25380	59.0	1.2e-75	280.4
Bma02g01353	BCT	1	585	Chloroplast and Mitochondria Gene Families	AT4G21490	71.2	1.8e-243	838.6
Bma01g00537	.	2	465	Chloroplast and Mitochondria Gene Families	AT4G21490	77.4	4.9e-212	734.2
Bma15g00329	.	5	186	Chloroplast and Mitochondria Gene Families	AT1G17530	62.2	2.3e-59	225.3
Bma15g00329	.	4	190	Chloroplast and Mitochondria Gene Families	AT3G04800	50.8	6.0e-42	167.5
Bma15g00329	.	6	190	Chloroplast and Mitochondria Gene Families	AT1G72750	65.1	1.2e-61	233.0
Bma01g00150	.	7	233	Chloroplast and Mitochondria Gene Families	AT1G26100	66.4	4.8e-81	297.7
Bma08g00335	.	23	234	Chloroplast and Mitochondria Gene Families	AT4G25570	61.8	4.1e-71	265.0
Bma01g01227	.	7	371	Chloroplast and Mitochondria Gene Families	AT5G14040	80.3	6.1e-171	597.0
Bma06g00281	.	12	371	Chloroplast and Mitochondria Gene Families	AT5G14040	77.0	3.7e-160	561.2
Bma08g00712	.	10	248	Chloroplast and Mitochondria Gene Families	AT5G14040	52.7	1.9e-71	266.5
Bma01g01227	.	8	370	Chloroplast and Mitochondria Gene Families	AT3G48850	69.5	4.2e-145	511.1
Bma06g00281	.	11	368	Chloroplast and Mitochondria Gene Families	AT3G48850	68.7	2.0e-142	502.3
Bma08g00712	.	10	252	Chloroplast and Mitochondria Gene Families	AT3G48850	50.6	2.6e-70	262.7
Bma08g00712	.	6	250	Chloroplast and Mitochondria Gene Families	AT2G17270	71.5	6.2e-105	377.5
Bma01g01227	.	70	370	Chloroplast and Mitochondria Gene Families	AT2G17270	52.3	1.9e-85	312.8
Bma06g00281	.	70	368	Chloroplast and Mitochondria Gene Families	AT2G17270	50.2	3.0e-83	305.4
Bma13g00190	.	5	177	Chloroplast and Mitochondria Gene Families	AT5G15640	69.1	2.6e-66	249.2
Bma04g00118	.	12	339	Chloroplast and Mitochondria Gene Families	AT5G26200	66.8	8.9e-121	430.3
Bma15g00327	.	1	368	Chloroplast and Mitochondria Gene Families	AT5G26200	52.5	1.3e-92	336.7
Bma15g00327	.	1	371	Chloroplast and Mitochondria Gene Families	AT1G72820	66.0	5.3e-129	457.6
Bma04g00118	.	1	339	Chloroplast and Mitochondria Gene Families	AT1G72820	67.2	3.6e-125	444.9
Bma14g02044	.	1	219	Chloroplast and Mitochondria Gene Families	AT4G25700	62.8	1.1e-71	266.5
Bma14g00601	.	358	447	Chloroplast and Mitochondria Gene Families	AT4G25700	80.0	2.3e-40	162.5
Bma07g01335	.	3	258	Chloroplast and Mitochondria Gene Families	AT5G54290	84.5	2.2e-114	409.1
Bma01g00348	.	86	514	Chloroplast and Mitochondria Gene Families	AT2G18710	88.3	6.9e-216	746.9

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0000158	13	5	7	13	5	6	0	6	5	5	5	5	10	6	7	9	5	6	7	6	6	18	5	5	6	7	8	8	5	2	201

Transcriptome

Select	Gene	Chr	Type	da1	da2	da3	da4	da5	da6	da7	da8	da9	da10
	Bma11g00950	Bma_Chr11	FPKM	67.46476	59.047462	0.0	0.0	1.461037	0.0	0.0	0.0	0.0	0.608021