Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bpe03g01190 ATGAACGACTTGTTTTCTTCCCGGTCTTTCTCCCGCGGTCGAACAGGCGTTGAGATGACGAATTCGAATTCACCGACCGCCGTCAATCTCGACAAGTTCTTCGAGGACGCTGAGTCGGTGAAGGACGAGCTGAGGGAGCTCGACGATTTGTATACTCGACTGAAACATTCTCATGAGCAGAGCAAGACTCTCCACAACGCAAAGACCGTGAAGGACCTCCGTTCTCGAATGGACTCGGATGTATCTCTCGCTCTCAAGAAAGCGAAGCTCATTAAGGTTCGGTTGGAAGCCTTAGACAGGGCTAATGCTGCTAATCGGAGCTTACCTGGCTGTGGACCAGGATCTTCGTCGGACCGGACGAGAACGTCGGTGGTCAACGGGCTGAGGAAGAAATTGCAGGACTCTATGGAGAGCTTCAACAATCTGAGGCAGGAGATCTCATCGGAATACAGAGATACCGTACAGCGGAGGTACTACACCGTCACCGGAGAAAATCCTGACGAGAAAACCATTGACCTACTGATCTCTACAGGGGAAAGCGAGACATTCTTGCAGAGAGCGATTCAAGAACAAGGAAGAGGCAGAGTTTTGGACACCATCAATGAAATTCAAGAGAGGCACGATGCAGTAAAAGATATGGAGAAGAACCTCAAGGAACTCCACCAAGTTTTCATGGATATGTCCGTGTTGGTGCAGGCTCAAGGAGAGCAACTCGACGACATTGAGAGCCAAGTGGCAAGAGCTCATTCGTTCGTTAGAGGCGGAACGCAGGAGTTGCACACGGCGAGGGTATATCAGAAAAATACACGGAAATGGGTGATTATTTCTGTTGTTGTTTTGGTGATTATCATCATTGTGATTGTTCTTATAATCGTTAAGCCTGGGAGTAATAGTGGTAATTCATCGTCGCCATAG 915 48.63 MNDLFSSRSFSRGRTGVEMTNSNSPTAVNLDKFFEDAESVKDELRELDDLYTRLKHSHEQSKTLHNAKTVKDLRSRMDSDVSLALKKAKLIKVRLEALDRANAANRSLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQEISSEYRDTVQRRYYTVTGENPDEKTIDLLISTGESETFLQRAIQEQGRGRVLDTINEIQERHDAVKDMEKNLKELHQVFMDMSVLVQAQGEQLDDIESQVARAHSFVRGGTQELHTARVYQKNTRKWVIISVVVLVIIIIVIVLIIVKPGSNSGNSSSP 304
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
3 30806605 30807990 - Bpe013086.1 Bpe03g01190 101695

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bpe03g01190 304 CDD SynN 30 187 IPR006011 GO:0016020
Bpe03g01190 304 CDD SNARE_syntaxin1-like 199 259 - -
Bpe03g01190 304 PANTHER BNAA05G27280D PROTEIN 8 293 - -
Bpe03g01190 304 ProSitePatterns Syntaxin / epimorphin family signature. 206 245 IPR006012 GO:0005484|GO:0006886|GO:0016020
Bpe03g01190 304 Gene3D - 28 160 - -
Bpe03g01190 304 SUPERFAMILY t-snare proteins 29 255 IPR010989 GO:0016020|GO:0016192
Bpe03g01190 304 Coils Coil 125 149 - -
Bpe03g01190 304 Gene3D - 196 293 - -
Bpe03g01190 304 Pfam SNARE domain 236 288 IPR000727 -
Bpe03g01190 304 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 200 262 IPR000727 -
Bpe03g01190 304 Coils Coil 200 220 - -
Bpe03g01190 304 SMART tSNARE_6 195 262 IPR000727 -
Bpe03g01190 304 PANTHER SYNTAXIN 8 293 IPR045242 -
Bpe03g01190 304 Coils Coil 30 57 - -
Bpe03g01190 304 Pfam Syntaxin 32 235 IPR006011 GO:0016020
Bpe03g01190 304 SMART SynN_4 25 151 IPR006011 GO:0016020
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bpe03g01190 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101208931 463.381
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bpe03g01190 Bpe-Chr3:30806605 Bpe08g00351 Bpe-Chr8:2103594 7.08E-126 dispersed
Bpe02g00700 Bpe-Chr2:4746882 Bpe03g01190 Bpe-Chr3:30806605 1.19E-142 wgd
Bpe03g01190 Bpe-Chr3:30806605 Bpe04g01486 Bpe-Chr4:21389123 7.31E-177 wgd
Bpe03g01190 Bpe-Chr3:30806605 Bpe04g00619 Bpe-Chr4:3961756 6.41E-151 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bpe02g01227 . 1 339 SNARE and Associated Proteins AT3G24350 65.7 2.7e-104 375.6
Bpe14g00562 . 444 797 SNARE and Associated Proteins AT3G24350 60.2 4.0e-100 361.7
Bpe15g00424 . 1 290 SNARE and Associated Proteins AT2G18260 55.0 1.3e-80 296.6
Bpe07g00425 . 1 293 SNARE and Associated Proteins AT2G18260 51.2 2.6e-76 282.3
Bpe04g01486 . 1269 1525 SNARE and Associated Proteins AT3G11820 80.9 1.2e-113 406.4
Bpe03g01190 . 22 278 SNARE and Associated Proteins AT3G11820 79.0 1.1e-111 399.8
Bpe04g00619 . 19 279 SNARE and Associated Proteins AT3G11820 74.7 5.0e-107 384.4
Bpe02g00700 . 19 279 SNARE and Associated Proteins AT3G11820 70.1 1.9e-98 355.9
Bpe08g00351 . 36 286 SNARE and Associated Proteins AT3G11820 66.1 8.3e-94 340.5
Bpe01g00396 . 36 286 SNARE and Associated Proteins AT3G11820 65.7 7.0e-93 337.4
Bpe04g01486 . 1276 1525 SNARE and Associated Proteins AT3G52400 69.6 3.5e-90 328.6
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT3G52400 61.9 7.3e-88 320.9
Bpe03g01190 . 29 278 SNARE and Associated Proteins AT3G52400 66.4 1.6e-87 319.7
Bpe02g00700 . 1 279 SNARE and Associated Proteins AT3G52400 60.8 6.9e-86 314.3
Bpe08g00351 . 6 286 SNARE and Associated Proteins AT3G52400 56.4 3.0e-81 298.9
Bpe01g00396 . 6 286 SNARE and Associated Proteins AT3G52400 55.7 4.3e-80 295.0
Bpe01g00396 . 6 304 SNARE and Associated Proteins AT4G03330 66.9 3.7e-107 384.8
Bpe08g00351 . 6 304 SNARE and Associated Proteins AT4G03330 66.6 1.4e-106 382.9
Bpe04g01486 . 1248 1525 SNARE and Associated Proteins AT4G03330 58.4 2.0e-84 309.3
Bpe03g01190 . 29 278 SNARE and Associated Proteins AT4G03330 58.0 6.6e-80 294.3
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT4G03330 55.4 6.2e-78 287.7
Bpe02g00700 . 1 284 SNARE and Associated Proteins AT4G03330 51.7 1.9e-74 276.2
Bpe01g00396 . 6 304 SNARE and Associated Proteins AT1G61290 78.6 2.3e-125 445.3
Bpe08g00351 . 6 308 SNARE and Associated Proteins AT1G61290 77.2 1.6e-123 439.1
Bpe04g01486 . 1248 1519 SNARE and Associated Proteins AT1G61290 62.9 9.1e-90 327.0
Bpe03g01190 . 1 277 SNARE and Associated Proteins AT1G61290 58.9 1.0e-85 313.5
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT1G61290 59.8 1.5e-84 309.7
Bpe02g00700 . 1 294 SNARE and Associated Proteins AT1G61290 53.4 2.1e-78 289.3
Bpe01g00396 . 6 304 SNARE and Associated Proteins AT1G11250 76.3 1.7e-120 429.1
Bpe08g00351 . 6 308 SNARE and Associated Proteins AT1G11250 75.9 2.9e-120 428.3
Bpe04g01486 . 1248 1519 SNARE and Associated Proteins AT1G11250 64.0 1.0e-93 340.1
Bpe03g01190 . 1 278 SNARE and Associated Proteins AT1G11250 59.7 5.2e-90 327.8
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT1G11250 61.3 1.7e-88 322.8
Bpe02g00700 . 1 284 SNARE and Associated Proteins AT1G11250 56.7 9.0e-82 300.4
Bpe07g00604 . 1 232 SNARE and Associated Proteins AT3G03800 59.9 2.3e-64 242.7
Bpe07g00233 BCT 1 263 SNARE and Associated Proteins AT5G16830 63.6 9.6e-78 287.0
Bpe05g00520 BCT 1 263 SNARE and Associated Proteins AT5G16830 62.1 1.5e-75 279.6
Bpe05g00520 BCT 1 274 SNARE and Associated Proteins AT5G46860 69.7 3.3e-83 305.1
Bpe07g00233 BCT 1 274 SNARE and Associated Proteins AT5G46860 70.4 7.3e-83 303.9
Bpe05g00520 BCT 1 257 SNARE and Associated Proteins AT4G17730 65.8 6.5e-76 280.8
Bpe07g00233 BCT 1 257 SNARE and Associated Proteins AT4G17730 64.6 3.2e-75 278.5
Bpe14g01345 . 1 182 SNARE and Associated Proteins AT4G17730 52.6 4.2e-43 171.8
Bpe07g00233 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 2.3e-49 193.0
Bpe05g00520 BCT 65 256 SNARE and Associated Proteins AT1G32270 57.3 2.0e-48 189.9
Bpe15g01148 . 5 341 SNARE and Associated Proteins AT5G05760 64.9 3.6e-111 398.3
Bpe02g01227 . 1 339 SNARE and Associated Proteins AT3G24350 65.7 2.7e-104 375.6
Bpe14g00562 . 444 797 SNARE and Associated Proteins AT3G24350 60.2 4.0e-100 361.7
Bpe02g01831 . 1 340 SNARE and Associated Proteins AT5G26980 76.2 1.1e-128 456.4
Bpe02g01831 . 1 338 SNARE and Associated Proteins AT4G02195 63.2 1.2e-103 373.2
Bpe02g01831 . 1 338 SNARE and Associated Proteins AT3G05710 76.0 1.7e-129 459.1
Bpe08g01109 CCT 1 225 SNARE and Associated Proteins AT1G16240 70.4 3.5e-81 298.1
Bpe03g00767 CCT 1 231 SNARE and Associated Proteins AT1G16240 57.7 2.0e-68 255.8
Bpe08g01109 CCT 1 225 SNARE and Associated Proteins AT1G79590 70.4 6.5e-84 307.4
Bpe03g00767 CCT 1 231 SNARE and Associated Proteins AT1G79590 59.8 1.2e-69 260.0
Bpe08g01119 . 58 251 SNARE and Associated Proteins AT1G28490 70.1 1.9e-67 252.3
Bpe11g00552 . 86 276 SNARE and Associated Proteins AT1G28490 66.5 5.1e-65 244.2
Bpe01g00179 . 1 286 SNARE and Associated Proteins AT3G09740 56.1 2.0e-80 295.8
Bpe04g01584 . 547 680 SNARE and Associated Proteins AT3G09740 64.6 2.0e-40 162.9
Bpe01g00179 . 1 286 SNARE and Associated Proteins AT3G45280 55.7 5.4e-78 287.7
Bpe01g00179 . 1 286 SNARE and Associated Proteins AT3G61450 52.6 9.3e-75 276.9
Bpe15g01257 . 65 262 SNARE and Associated Proteins AT1G51740 66.0 2.8e-65 245.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bpe03g01190 Bpe_Chr03 FPKM 2.287179 3.749552 0.0 0.0 0.0 0.0 0.0 0.0 0.553922 0.999917