Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bpe04g00458 AAAATGTCGTTAGGGAAGAGACCTCGCCCGCCGATGAAAAGAACGACCAGCATGACGGGGATCACCTTTGATCTGGGTGTTAATGGCTGCCAAGTTGCAGCTCCACCGTCTGATCCTCAAAGCCTGTTTTTAAGCTACCATGGTATGGCCCATAAACAGAGCCTTGATGGTTCAGATCGACGGCTACTAACCATGGTCTCACCCAGAAACCAAAGGAGTCATTCTTGTGATTTCCAGTTTGAAACGGCTCAGTTCTTAAAAGCTTGCTCCCTCTGCCAGCGTCGTCTAGTTCCCGGTCGAGACATTTACATGTACAGGGGAGACAGTGCTTTCTGTAGCCTAGAATGCAGGCAACACCAGATGAATCAAGACGAGACGAAGGAAAAGTGCTCTTTAGCATCAAAGAAAGAAGCAGCTTCTTCTTCATCTGTCTCTGCTGCTGCTCAAGTTCCCTCCAATGTCGAAACTGTAGCCGCCTTATAG 483 48.45 KMSLGKRPRPPMKRTTSMTGITFDLGVNGCQVAAPPSDPQSLFLSYHGMAHKQSLDGSDRRLLTMVSPRNQRSHSCDFQFETAQFLKACSLCQRRLVPGRDIYMYRGDSAFCSLECRQHQMNQDETKEKCSLASKKEAASSSSVSAAAQVPSNVETVAAL 160
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 2929525 2930092 + Bpe015145.1 Bpe04g00458 102267

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bpe04g00458 160 ProSiteProfiles Zinc finger FLZ-type profile. 84 128 IPR007650 -
Bpe04g00458 160 PANTHER FCS-LIKE ZINC FINGER 5 1 147 - -
Bpe04g00458 160 MobiDBLite consensus disorder prediction 139 160 - -
Bpe04g00458 160 Pfam zinc-finger of the FCS-type, C2-C2 79 127 IPR007650 -
Bpe04g00458 160 PANTHER - 1 147 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bpe04g00458 - - - mnt:21404393 153.68
       

WGDs- Genes

Select Gene_1 Gene_2 Event_name
Bpe02g00093 Bpe04g00458 BCT
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bpe04g00458 Bpe-Chr4:2929525 Bpe06g00076 Bpe-Chr6:1018062 3.98E-35 dispersed
Bpe04g01138 Bpe-Chr4:10128659 Bpe04g00458 Bpe-Chr4:2929525 5.39E-13 transposed
Bpe14g00359 Bpe-Chr14:3432942 Bpe04g00458 Bpe-Chr4:2929525 7.32E-41 transposed
Bpe05g00828 Bpe-Chr5:21544195 Bpe04g00458 Bpe-Chr4:2929525 9.99E-13 transposed
Bpe02g00093 Bpe-Chr2:699733 Bpe04g00458 Bpe-Chr4:2929525 1.65E-80 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi18g376 . Blo12g00696 . Bda03g00503 Bpe02g00093 Bpe04g00458 . Bma01g02624 . . . Cma09g00649 . . . . . . . . . . . . . . . . . . . . . . . . Csa04g01846 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001468 2 2 3 4 3 1 4 2 2 2 2 2 4 2 1 4 2 1 4 2 2 2 2 2 2 2 2 4 2 1 70
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bpe04g00458 Bpe_Chr04 FPKM 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.118936 0.074088 0.0