Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bpe04g01879 ATGACTTCCAACACCTTAATGAGCTGCGGAATTACAGCAGTGGCCTACCCGTCCGTCCTCTCGTCGTCCAAATCGAAGTTTGCCGCCGCATTTTCACTTCCTTCCGGCTATGCCAATGCGTCGTCGCGCTTCTCCATGTCAGCCGAGTGGATGCCCGGCCAGCCCAGACCTCCATACCTGGATGGCTCAGCTCCAGGAGATTTTGGGTTTGATCCACTTGGATTGGGTGAAGTTCCAGAGAATCTGGAGAGATTCAAAGAGTCTGAACTCATCCATTGCAGATGGGCTATGCTCGCCGTACCAGGGGTCCTACTTCCAGAGGCATTGGGGTTAGGCAACTGGGTGAAGGCCCAAGAGTGGGCGGCAATTCCCGGCGGCCAAGCCACCTACCTGGGGCAGCCAGTTCCTTGGGGTACATTACCCATAATTTTGGTCATCGAGTTCCTCGCCATTGCTTTCGTAGAGCACCAACGCAGCATGGAAAAAGACACAGAAAAGAAGAAATACCCCGGCGGCGCATTTGATCCCCTGGGCTTCTCCAAAGACCCTGCAAAGTTCAAGGAATACAAAGTCAAAGAGATTAAAAATGGTCGGCTGGCGCTGCTGGCATTTGTTGGGTTCTGTGTGCAGCAATCTGCCTACCCAGGCACAGGGCCGTTGGAGAACTTGGCCACTCACTTGGCTGACCCATGGCACAACAACATCGGCGATATCATCATTCCAAGAGGGGTTTTGCCTTGA 741 53.58 MTSNTLMSCGITAVAYPSVLSSSKSKFAAAFSLPSGYANASSRFSMSAEWMPGQPRPPYLDGSAPGDFGFDPLGLGEVPENLERFKESELIHCRWAMLAVPGVLLPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPIILVIEFLAIAFVEHQRSMEKDTEKKKYPGGAFDPLGFSKDPAKFKEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIIIPRGVLP 246
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
4 23879251 23880400 + Bpe016583.1 Bpe04g01879 103688

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bpe04g01879 246 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 6, CHLOROPLASTIC 22 237 - -
Bpe04g01879 246 Pfam Chlorophyll A-B binding protein 57 211 IPR022796 -
Bpe04g01879 246 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 22 237 IPR001344 GO:0009765|GO:0016020
Bpe04g01879 246 SUPERFAMILY Chlorophyll a-b binding protein 39 240 - -
Bpe04g01879 246 Gene3D Chlorophyll a/b binding protein domain 51 237 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bpe04g01879 K08907 LHCA1; light-harvesting complex I chlorophyll a/b binding protein 1 - pvy:116130060 461.455
       

WGDs- Genes


Select Gene_1 Gene_2 Event_name
Bpe04g01879 Bpe15g01065 CCT
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bpe03g01003 Bpe-Chr3:29538794 Bpe04g01879 Bpe-Chr4:23879251 9.20E-40 dispersed
Bpe04g01879 Bpe-Chr4:23879251 Bpe12g00541 Bpe-Chr12:11278473 6.22E-47 dispersed
Bpe15g01065 Bpe-Chr15:19919108 Bpe04g01879 Bpe-Chr4:23879251 1.03E-175 wgd
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi13g497 . . . Bda15g00170 . Bpe15g01065 Bma03g00334 . . . . . . . . Cpe13g00808 . . . . . . . . . . . . . . . Cone1ag1346 Cone5ag0333 . . Lsi02g01721 . . . Blo13g00725 Blo04g00315 Bda14g00345 . Bpe04g01879 . . Bma08g00942 . Cmo04g02705 Cmo15g00458 Cma04g02584 Cma15g00450 Car04g02495 Car15g00417 . Cpe01g02245 . . . . . . . . . . . . . . . Csa05g01755 . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bpe08g01364 CCT,ECH 1 366 Chloroplast and Mitochondria Gene Families AT2G28800 66.4 4.0e-131 464.9
Bpe13g01495 . 57 426 Chloroplast and Mitochondria Gene Families AT2G28800 52.8 1.3e-97 353.6
Bpe11g00765 . 29 305 Chloroplast and Mitochondria Gene Families AT2G28800 58.0 1.7e-89 326.6
Bpe05g00414 . 3 254 Chloroplast and Mitochondria Gene Families AT1G15820 77.3 2.9e-113 404.8
Bpe07g00339 . 59 310 Chloroplast and Mitochondria Gene Families AT1G15820 75.4 8.0e-111 396.7
Bpe14g00731 . 1 267 Chloroplast and Mitochondria Gene Families AT3G27690 89.9 1.1e-143 506.1
Bpe07g00657 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 90.2 1.4e-143 505.8
Bpe02g00968 . 1 229 Chloroplast and Mitochondria Gene Families AT3G27690 85.2 1.6e-118 422.5
Bpe11g00504 . 7 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.8 1.1e-98 356.7
Bpe11g01102 . 1 160 Chloroplast and Mitochondria Gene Families AT3G27690 86.9 1.2e-81 300.1
Bpe03g00505 . 1 160 Chloroplast and Mitochondria Gene Families AT3G27690 86.3 2.0e-81 299.3
Bpe13g01150 . 103 324 Chloroplast and Mitochondria Gene Families AT3G27690 51.4 4.2e-55 211.8
Bpe02g00247 . 69 274 Chloroplast and Mitochondria Gene Families AT3G27690 54.0 2.5e-52 202.6
Bpe11g01542 . 117 238 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 4.3e-52 201.8
Bpe11g01103 . 1 98 Chloroplast and Mitochondria Gene Families AT3G27690 85.7 6.1e-46 181.4
Bpe03g01097 . 5 270 Chloroplast and Mitochondria Gene Families AT3G61470 77.8 4.8e-124 440.7
Bpe04g01392 . 1 207 Chloroplast and Mitochondria Gene Families AT3G61470 88.9 1.5e-117 419.1
Bpe12g00541 CCT,ECH 20 242 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 1.9e-64 242.7
Bpe07g00779 CCT,ECH 1 177 Chloroplast and Mitochondria Gene Families AT3G61470 58.5 1.6e-58 223.0
Bpe15g01065 CCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.3 1.7e-90 328.9
Bpe04g01879 CCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.3 3.2e-89 324.7
Bpe02g00914 . 1 313 Chloroplast and Mitochondria Gene Families AT3G08940 77.1 3.7e-133 471.1
Bpe03g01003 . 1 311 Chloroplast and Mitochondria Gene Families AT3G08940 76.9 1.1e-132 469.5
Bpe13g01150 . 34 331 Chloroplast and Mitochondria Gene Families AT1G76570 78.6 1.8e-144 508.8
Bpe08g01246 . 1 272 Chloroplast and Mitochondria Gene Families AT1G61520 84.6 9.2e-134 473.0
Bpe11g00893 . 1 272 Chloroplast and Mitochondria Gene Families AT1G61520 84.2 6.0e-133 470.3
Bpe07g00657 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 1.4e-142 502.3
Bpe14g00731 . 1 267 Chloroplast and Mitochondria Gene Families AT2G05070 89.9 1.4e-142 502.3
Bpe02g00968 . 1 229 Chloroplast and Mitochondria Gene Families AT2G05070 85.2 3.1e-118 421.4
Bpe11g00504 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 9.4e-99 356.7
Bpe11g01102 . 1 160 Chloroplast and Mitochondria Gene Families AT2G05070 86.9 2.3e-81 298.9
Bpe03g00505 . 1 160 Chloroplast and Mitochondria Gene Families AT2G05070 86.3 4.0e-81 298.1
Bpe13g01150 . 103 327 Chloroplast and Mitochondria Gene Families AT2G05070 50.2 9.2e-54 207.2
Bpe02g00247 . 69 274 Chloroplast and Mitochondria Gene Families AT2G05070 54.5 1.7e-52 203.0
Bpe11g01542 . 117 238 Chloroplast and Mitochondria Gene Families AT2G05070 76.2 9.5e-51 197.2
Bpe11g01103 . 1 98 Chloroplast and Mitochondria Gene Families AT2G05070 85.7 7.1e-46 181.0
Bpe14g00731 . 1 239 Chloroplast and Mitochondria Gene Families AT2G05100 90.4 1.4e-125 446.0
Bpe07g00657 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.9 1.8e-125 445.7
Bpe02g00968 . 1 201 Chloroplast and Mitochondria Gene Families AT2G05100 84.1 4.6e-100 361.3
Bpe11g00504 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.2 2.3e-83 305.8
Bpe11g01102 . 1 132 Chloroplast and Mitochondria Gene Families AT2G05100 85.6 3.4e-63 238.8
Bpe03g00505 . 1 132 Chloroplast and Mitochondria Gene Families AT2G05100 84.8 5.8e-63 238.0
Bpe02g00247 . 69 258 Chloroplast and Mitochondria Gene Families AT2G05100 53.8 2.1e-44 176.4
Bpe03g01003 . 1 168 Chloroplast and Mitochondria Gene Families AT2G40100 67.8 8.4e-62 233.4
Bpe02g00914 . 3 170 Chloroplast and Mitochondria Gene Families AT2G40100 65.1 5.4e-61 230.7
Bpe02g00968 . 1 229 Chloroplast and Mitochondria Gene Families AT1G29930 90.6 1.9e-123 438.7
Bpe14g00731 . 35 267 Chloroplast and Mitochondria Gene Families AT1G29930 85.2 9.1e-118 419.9
Bpe07g00657 . 33 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.4 5.9e-117 417.2
Bpe11g00504 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 75.9 4.9e-95 344.4
Bpe11g01102 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29930 92.5 1.0e-84 310.1
Bpe03g00505 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29930 91.9 1.7e-84 309.3
Bpe02g00247 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29930 53.8 5.4e-54 208.0
Bpe11g01542 . 117 238 Chloroplast and Mitochondria Gene Families AT1G29930 81.3 2.7e-53 205.7
Bpe11g01103 . 1 98 Chloroplast and Mitochondria Gene Families AT1G29930 90.9 7.6e-48 187.6
Bpe02g00968 . 1 229 Chloroplast and Mitochondria Gene Families AT1G29920 90.6 1.9e-123 438.7
Bpe14g00731 . 35 267 Chloroplast and Mitochondria Gene Families AT1G29920 85.2 9.1e-118 419.9
Bpe07g00657 . 33 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.4 5.9e-117 417.2
Bpe11g00504 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 75.9 4.9e-95 344.4
Bpe11g01102 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29920 92.5 1.0e-84 310.1
Bpe03g00505 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29920 91.9 1.7e-84 309.3
Bpe02g00247 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29920 53.8 5.4e-54 208.0
Bpe11g01542 . 117 238 Chloroplast and Mitochondria Gene Families AT1G29920 81.3 2.7e-53 205.7
Bpe11g01103 . 1 98 Chloroplast and Mitochondria Gene Families AT1G29920 90.9 7.6e-48 187.6
Bpe02g00968 . 1 229 Chloroplast and Mitochondria Gene Families AT1G29910 90.6 1.9e-123 438.7
Bpe14g00731 . 35 267 Chloroplast and Mitochondria Gene Families AT1G29910 85.2 9.1e-118 419.9
Bpe07g00657 . 33 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.4 5.9e-117 417.2
Bpe11g00504 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 75.9 4.9e-95 344.4
Bpe11g01102 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29910 92.5 1.0e-84 310.1
Bpe03g00505 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29910 91.9 1.7e-84 309.3
Bpe02g00247 . 69 274 Chloroplast and Mitochondria Gene Families AT1G29910 53.8 5.4e-54 208.0
Bpe11g01542 . 117 238 Chloroplast and Mitochondria Gene Families AT1G29910 81.3 2.7e-53 205.7
Bpe11g01103 . 1 98 Chloroplast and Mitochondria Gene Families AT1G29910 90.9 7.6e-48 187.6
Bpe02g00247 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 86.0 6.6e-143 503.4
Bpe02g00968 . 13 217 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 2.7e-56 215.7
Bpe14g00731 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 1.0e-55 213.8
Bpe07g00657 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 1.8e-55 213.0
Bpe11g00504 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 7.7e-51 197.6
Bpe03g00505 . 1 148 Chloroplast and Mitochondria Gene Families AT4G10340 53.7 5.7e-38 154.8
Bpe11g01102 . 1 148 Chloroplast and Mitochondria Gene Families AT4G10340 53.0 9.7e-38 154.1
Bpe02g00968 . 1 229 Chloroplast and Mitochondria Gene Families AT2G34420 91.0 1.1e-123 439.5
Bpe14g00731 . 35 267 Chloroplast and Mitochondria Gene Families AT2G34420 84.8 2.0e-117 418.7
Bpe07g00657 . 33 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.0 1.3e-116 416.0
Bpe11g00504 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 76.4 6.3e-95 344.0
Bpe11g01102 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34420 93.2 5.9e-85 310.8
Bpe03g00505 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34420 92.5 1.0e-84 310.1
Bpe11g01542 . 117 238 Chloroplast and Mitochondria Gene Families AT2G34420 82.1 1.2e-53 206.8
Bpe02g00247 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34420 53.3 1.6e-53 206.5
Bpe11g01103 . 1 98 Chloroplast and Mitochondria Gene Families AT2G34420 91.9 4.4e-48 188.3
Bpe02g00968 . 1 229 Chloroplast and Mitochondria Gene Families AT2G34430 91.0 7.9e-122 433.3
Bpe14g00731 . 35 267 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 1.7e-116 415.6
Bpe07g00657 . 33 265 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 1.1e-115 412.9
Bpe11g00504 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34430 76.4 8.2e-95 343.6
Bpe11g01102 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34430 93.2 5.9e-85 310.8
Bpe03g00505 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34430 92.5 1.0e-84 310.1
Bpe11g01542 . 117 238 Chloroplast and Mitochondria Gene Families AT2G34430 82.1 1.2e-53 206.8
Bpe02g00247 . 69 274 Chloroplast and Mitochondria Gene Families AT2G34430 53.3 2.1e-53 206.1
Bpe11g01103 . 1 98 Chloroplast and Mitochondria Gene Families AT2G34430 91.9 4.4e-48 188.3
Bpe03g01003 . 5 311 Chloroplast and Mitochondria Gene Families AT5G01530 77.4 2.8e-136 481.5
Bpe02g00914 . 8 313 Chloroplast and Mitochondria Gene Families AT5G01530 76.5 2.0e-131 465.3
Bpe02g01522 BCT 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 4.7e-143 503.8
Bpe14g00222 BCT 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 92.7 1.0e-142 502.7
Bpe14g00222 BCT 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.8 4.2e-151 530.8
Bpe02g01522 BCT 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.0 1.2e-150 529.3
Bpe08g01410 BCT 4 327 Chloroplast and Mitochondria Gene Families AT2G30160 73.5 1.2e-140 496.1
Bpe08g00049 . 5 323 Chloroplast and Mitochondria Gene Families AT2G30160 72.2 4.9e-137 484.2
Bpe01g00070 BCT 1 321 Chloroplast and Mitochondria Gene Families AT2G30160 72.1 2.9e-134 474.9
Bpe11g01176 . 4 319 Chloroplast and Mitochondria Gene Families AT2G30160 66.2 6.2e-116 414.1
Bpe08g00049 . 1 323 Chloroplast and Mitochondria Gene Families AT1G07030 72.8 1.6e-137 485.7
Bpe01g00070 BCT 1 321 Chloroplast and Mitochondria Gene Families AT1G07030 73.0 3.1e-136 481.5
Bpe08g01410 BCT 4 326 Chloroplast and Mitochondria Gene Families AT1G07030 72.1 1.7e-134 475.7
Bpe11g01176 . 8 319 Chloroplast and Mitochondria Gene Families AT1G07030 69.3 3.4e-119 424.9
Bpe11g00156 . 1 312 Chloroplast and Mitochondria Gene Families AT2G47490 75.9 1.4e-133 472.6
Bpe13g01035 . 24 325 Chloroplast and Mitochondria Gene Families AT2G47490 60.8 5.5e-106 380.9
Bpe13g01035 . 25 320 Chloroplast and Mitochondria Gene Families AT1G25380 69.0 1.4e-113 406.4
Bpe11g00156 . 16 298 Chloroplast and Mitochondria Gene Families AT1G25380 66.0 3.2e-105 378.6
Bpe14g00677 CCT 1 586 Chloroplast and Mitochondria Gene Families AT4G21490 70.5 3.7e-241 830.9
Bpe02g01920 . 1 531 Chloroplast and Mitochondria Gene Families AT4G21490 74.6 6.3e-233 803.5
Bpe15g00698 CCT 2 541 Chloroplast and Mitochondria Gene Families AT4G21490 66.8 1.3e-217 752.7
Bpe10g00693 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 62.7 3.5e-60 228.0
Bpe05g00274 . 4 178 Chloroplast and Mitochondria Gene Families AT1G17530 52.0 1.3e-43 172.9
Bpe05g00274 . 4 182 Chloroplast and Mitochondria Gene Families AT3G04800 54.4 1.1e-45 179.9
Bpe10g00693 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 52.7 1.0e-38 156.8
Bpe10g00693 . 22 186 Chloroplast and Mitochondria Gene Families AT1G72750 70.4 4.7e-60 227.6
Bpe05g00274 . 4 182 Chloroplast and Mitochondria Gene Families AT1G72750 53.3 2.2e-46 182.2
Bpe02g02291 . 7 240 Chloroplast and Mitochondria Gene Families AT1G26100 64.4 4.6e-81 297.7
Bpe14g00119 . 1 278 Chloroplast and Mitochondria Gene Families AT5G38630 59.1 3.7e-83 304.7
Bpe12g00426 . 23 234 Chloroplast and Mitochondria Gene Families AT4G25570 60.8 6.1e-72 267.7
Bpe02g01298 . 7 371 Chloroplast and Mitochondria Gene Families AT5G14040 80.5 3.4e-171 597.8
Bpe14g01360 . 9 371 Chloroplast and Mitochondria Gene Families AT5G14040 79.3 4.5e-163 570.9
Bpe13g00186 . 10 352 Chloroplast and Mitochondria Gene Families AT5G14040 77.1 5.5e-153 537.3
Bpe12g00155 . 1 283 Chloroplast and Mitochondria Gene Families AT5G14040 51.6 2.7e-83 305.8
Bpe02g01298 . 8 370 Chloroplast and Mitochondria Gene Families AT3G48850 69.2 5.9e-144 507.3
Bpe13g00186 . 9 352 Chloroplast and Mitochondria Gene Families AT3G48850 70.6 6.7e-140 493.8
Bpe14g01360 . 8 366 Chloroplast and Mitochondria Gene Families AT3G48850 68.8 1.1e-139 493.0
Bpe12g00155 . 5 282 Chloroplast and Mitochondria Gene Families AT2G17270 74.1 6.1e-126 447.2
Bpe02g01298 . 70 370 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 1.1e-85 313.5
Bpe14g01360 . 70 361 Chloroplast and Mitochondria Gene Families AT2G17270 51.0 6.0e-81 297.7
Bpe13g00186 . 67 351 Chloroplast and Mitochondria Gene Families AT2G17270 50.5 8.7e-80 293.9
Bpe04g00116 . 12 339 Chloroplast and Mitochondria Gene Families AT5G26200 66.5 5.6e-120 427.6
Bpe10g00696 . 1 337 Chloroplast and Mitochondria Gene Families AT5G26200 61.3 1.9e-112 402.5
Bpe10g00696 . 1 340 Chloroplast and Mitochondria Gene Families AT1G72820 76.9 1.7e-148 522.3
Bpe04g00116 . 1 339 Chloroplast and Mitochondria Gene Families AT1G72820 67.2 2.2e-124 442.2
Bpe11g00666 . 99 313 Chloroplast and Mitochondria Gene Families AT5G52570 50.7 7.9e-49 190.7
Bpe03g00153 . 1 218 Chloroplast and Mitochondria Gene Families AT4G25700 62.4 2.0e-70 262.3
Bpe11g00666 . 49 229 Chloroplast and Mitochondria Gene Families AT4G25700 58.3 4.4e-57 218.0
Bpe08g01158 . 3 258 Chloroplast and Mitochondria Gene Families AT5G54290 84.5 5.6e-115 411.0
Bpe02g02103 . 6 436 Chloroplast and Mitochondria Gene Families AT2G18710 87.9 6.7e-216 746.9
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0005279 2 1 2 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 2 1 1 1 1 1 40
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bpe04g01879 Bpe_Chr04 FPKM 18.249556 20.085529 18.878176 18.761616 19.367685 22.007727 20.741255 19.623323 19.281361 19.416044