Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Bpe05g00828 ATGGTGGGTTTGAGCGTTGTTTTAGAAGCTCAAAAGAGTGGTTTCAGCAAAACAACTCAAGTTCTGAACAAAGCAACTCTTCCAATCAACAGTGCCAATCCATCCATTTCTCCTCGTAATCCATCAAACCCTTCATTTTCCAGCAATATTTTTCCCACTTTTCTGGACCACTGTTTTCTCTGCAAACAGAAACTCTTACCCGGCAACGATATCTACATGTACAAGGGAAACAAGGGTTTCTGTAGCGTGGAATGCAGGTGCAGGCAGATTTTCATGGATGAAGAAGAAAGTATTCAAAACAAGCACTGCTCATTGGCTGCTGCAAAACCTTCTTCTTCTTCTTCTTCTTCTTCCTCTCGTTCTCACAAACCCACGAAAAACAAGGCTGGGGGCTTTGCATACTAA 405 42.47 MVGLSVVLEAQKSGFSKTTQVLNKATLPINSANPSISPRNPSNPSFSSNIFPTFLDHCFLCKQKLLPGNDIYMYKGNKGFCSVECRCRQIFMDEEESIQNKHCSLAAAKPSSSSSSSSSRSHKPTKNKAGGFAY 134
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
5 21544195 21544791 + Bpe018241.1 Bpe05g00828 104605

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Bpe05g00828 134 PANTHER FCS-LIKE ZINC FINGER 15 1 134 - -
Bpe05g00828 134 MobiDBLite consensus disorder prediction 108 125 - -
Bpe05g00828 134 Pfam zinc-finger of the FCS-type, C2-C2 53 95 IPR007650 -
Bpe05g00828 134 PANTHER FCS-LIKE ZINC FINGER 5 1 134 - -
Bpe05g00828 134 ProSiteProfiles Zinc finger FLZ-type profile. 53 97 IPR007650 -
Bpe05g00828 134 MobiDBLite consensus disorder prediction 108 134 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bpe05g00828 - - - zju:107433133 150.984
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bpe04g01138 Bpe-Chr4:10128659 Bpe05g00828 Bpe-Chr5:21544195 5.50E-52 dispersed
Bpe05g00828 Bpe-Chr5:21544195 Bpe14g00359 Bpe-Chr14:3432942 5.77E-13 dispersed
Bpe05g00828 Bpe-Chr5:21544195 Bpe10g00076 Bpe-Chr10:1060118 9.35E-13 transposed
Bpe05g00828 Bpe-Chr5:21544195 Bpe04g00458 Bpe-Chr4:2929525 9.99E-13 transposed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi5g166 Blo01g00066 . . Bda08g00297 . . . . Cmo08g01209 . . . . . . Cpe08g00174 . . . . . . . . Cla06g00468 Cam06g0502 Cec06g0504 Cco06g0505 Clacu06g0486 Cmu06g0488 Cre06g1260 . . Cone7ag0137 Cone4ag0141 . . . . . . . . Bpe05g00828 . . . Sed09g0250 . . Cma08g01234 . . . . . Bhi12g02040 Tan06g2693 Cmetu11g0533 Lac11g0851 Hepe03g0091 . Lcy12g0744 Cla05g00665 Cam05g0729 Cec05g0736 Cco05g0736 Clacu05g0722 Cmu05g0687 Cre05g0761 Lsi09g01443 Csa03g01482 Chy06g00719 .
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002814 2 2 1 0 2 2 2 2 2 1 2 2 2 2 2 2 2 2 1 2 2 1 2 2 2 2 2 4 3 1 56
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bpe05g00828 Bpe_Chr05 FPKM 0.0 0.0 0.0 0.473094 0.53465 0.578081 0.0 0.0 0.0 0.0