Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Bpe07g00892 | ATGGATGCCCTAGACTCTGTCGTCGACCCTCTCAGGGATTTCGCAAAGGACAGCGTGCGCCTCGTCAAGAGATGTCACAAGCCTGATCGTAAAGAATTCACAAAGGTGGCATTCCGTACGGCTATCGGATTTGTTGTGATGGGATTCGTTGGATTCTTTGTGAAGCTGATTTTCATTCCCATCAATAATATAATCGTCGGATCTGGTTGA | 210 | 46.67 | MDALDSVVDPLRDFAKDSVRLVKRCHKPDRKEFTKVAFRTAIGFVVMGFVGFFVKLIFIPINNIIVGSG | 69 |
Gff information
| Chromosome | Start | End | Strand | Old_gene | Gene | Num |
|---|---|---|---|---|---|---|
| 7 | 14974056 | 14974390 | - | Bpe021733.1 | Bpe07g00892 | 106661 |
Annotation
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Bpe07g00892 | 69 | ProSitePatterns | Protein secE/sec61-gamma signature. | 14 | 42 | IPR001901 | GO:0006605|GO:0006886|GO:0016020 | |
| Bpe07g00892 | 69 | PANTHER | PROTEIN TRANSPORT PROTEIN SEC61 SUBUNIT GAMMA-3 | 1 | 69 | - | - | |
| Bpe07g00892 | 69 | Pfam | SecE/Sec61-gamma subunits of protein translocation complex | 13 | 65 | IPR001901 | GO:0006605|GO:0006886|GO:0016020 | |
| Bpe07g00892 | 69 | TIGRFAM | secE_euk_arch: protein translocase SEC61 complex gamma subunit, archaeal and eukaryotic | 8 | 66 | IPR008158 | GO:0008320|GO:0015031|GO:0016020 | |
| Bpe07g00892 | 69 | Gene3D | Preprotein translocase SecE subunit | 7 | 68 | IPR023391 | - | |
| Bpe07g00892 | 69 | Hamap | Protein translocase subunit SecE [secE]. | 9 | 64 | IPR001901 | GO:0006605|GO:0006886|GO:0016020 | |
| Bpe07g00892 | 69 | PANTHER | SEC61 GAMMA SUBUNIT | 1 | 69 | - | - | |
| Bpe07g00892 | 69 | SUPERFAMILY | Preprotein translocase SecE subunit | 5 | 65 | IPR023391 | - |
Pathway
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Bpe07g00892 | K07342 | SEC61G, SSS1, secE; protein transport protein SEC61 subunit gamma and related proteins | - | nnu:104591739 | 129.413 |
WGDs- Genes
| Select | Gene_1 | Gene_2 | Event_name |
|---|---|---|---|
| Bpe07g00892 | Bpe12g00479 | CCT | |
| Bpe07g00892 | Bpe13g00200 | CCT | |
| Bpe07g00892 | Bpe12g00479 | ECH | |
| Bpe07g00892 | Bpe13g00200 | ECH | |
| Bpe07g00892 | Bpe15g00222 | BCT |
Dupl-types
| Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
|---|---|---|---|---|---|---|
| Bpe12g00479 | Bpe-Chr12:10559664 | Bpe07g00892 | Bpe-Chr7:14974056 | 9.09E-44 | wgd | |
| Bpe13g00200 | Bpe-Chr13:9976332 | Bpe07g00892 | Bpe-Chr7:14974056 | 1.11E-36 | wgd | |
| Bpe15g00222 | Bpe-Chr15:13346986 | Bpe07g00892 | Bpe-Chr7:14974056 | 2.25E-37 | wgd |
Deco-Alignment
| Select | Vvi1 | Blo1 | Blo2 | Bda1 | Bda2 | Bpe1 | Bpe2 | Bma1 | Bma2 | Cmo1 | Cmo2 | Cma1 | Cma2 | Car1 | Car2 | Sed1 | Cpe1 | Cpe2 | Bhi1 | Tan1 | Cmetu1 | Lac1 | Hepe1 | Mch1 | Lcy1 | Cla1 | Cam1 | Cec1 | Cco1 | Clacu1 | Cmu1 | Cre1 | Cone1 | Cone2 | Cone3 | Cone4 | Lsi1 | Csa1 | Chy1 | Cme1 | Blo3 | Blo4 | Bda3 | Bda4 | Bpe3 | Bpe4 | Bma3 | Bma4 | Sed2 | Cmo3 | Cmo4 | Cma3 | Cma4 | Car3 | Car4 | Cpe3 | Cpe4 | Bhi2 | Tan2 | Cmetu2 | Lac2 | Hepe2 | Mch2 | Lcy2 | Cla2 | Cam2 | Cec2 | Cco2 | Clacu2 | Cmu2 | Cre2 | Lsi2 | Csa2 | Chy2 | Cme2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Vvi17g101 | . | Blo16g00272 | Bda06g00725 | . | Bpe12g00479 | Bpe13g00200 | Bma06g00261 | Bma12g01083 | Cmo13g00841 | Cmo18g00222 | . | . | . | . | . | Cpe20g00303 | . | Bhi02g00520 | . | . | . | . | . | . | . | . | . | . | . | . | . | Cone2ag0981 | Cone16ag0015 | Cone13ag0226 | Cone19ag0211 | Lsi02g00510 | Csa01g00972 | Chy12g01161 | Cme12g01585 | . | Blo15g00206 | Bda11g01596 | Bda14g01358 | Bpe07g00892 | Bpe15g00222 | Bma03g01251 | . | Sed08g2430 | . | . | Cma13g00811 | Cma18g00314 | Car13g00657 | Car18g00233 | Cpe09g00957 | . | Bhi08g01503 | Tan05g2975 | Cmetu12g2007 | Lac10g0589 | Hepe07g2115 | . | . | Cla03g00359 | Cam03g0379 | Cec03g0365 | . | Clacu03g0378 | Cmu03g0983 | Cre03g0675 | Lsi06g01644 | Csa01g00053 | . | . |
Syn-Orthogroups
| Select | Orthogroup | Bda | Bhi | Blo | Bma | Bpe | Cam | Car | Cco | Cec | Chy | Cla | Clacu | Cma | Cme | Cmetu | Cmo | Cmu | Cone | Cpe | Cre | Csa | HCH | Hepe | Lac | Lcy | Lsi | Mch | Sed | Tan | Vvi | Total |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| OG0001129 | 5 | 5 | 4 | 4 | 2 | 2 | 3 | 1 | 3 | 2 | 2 | 2 | 3 | 2 | 2 | 3 | 1 | 4 | 3 | 1 | 3 | 2 | 2 | 1 | 2 | 2 | 3 | 2 | 2 | 2 | 75 |
Transcriptome
| Select | Gene | Chr | Type | da1 | da2 | da3 | da4 | da5 | da6 | da7 | da8 | da9 | da10 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Bpe07g00892 | Bpe_Chr07 | FPKM | 0.583452 | 0.639553 | 0.0 | 0.393104 | 2.403586 | 3.873611 | 3.733998 | 0.650488 | 0.68161 | 0.364112 |