Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Bpe15g00169 | ATGTGCCGGAGTGACGAAGTCGATGCGGTTGACCATCGTCTGAGTCTTTTATCAGAGGTTCGGCTTCCTGCAACCCCCGGCGACGACTCCGATGGAGATGGGGATGCCCTCTTCATTCCTCCTCTCAACTTCTCGGCCGTCGACGCCGGCATTTTTCGCTCCGGCTTCCCTCATGACGCAAACTTCTCTTTCATTCAAACCCTAGGCCTCCGCTCCATCATATACCTTTGTCCGGAGCCTTATCCTGATTCAAATATGGAGTTTCTCAAGTCTAATGGAATCAAATTGTATCAATTCGGCATCGAAGGACATAAGGAGCCATTTGTAAACATCCCAGAGAATAAAATTCGTGAAGCACTGAGAGTTGTTCTTGATTCAAGGAATCACCCGCTTCTAATTCACTGTAAACGAGGAAAGCATCGAACTGGTTGTTTGGTGGGATGCCTGAGGAAAATGCAGAGATGGTGCTTATCGTCTGTATTTTCTGAGTACCAGCGATTTGCAGCGGCTAAAGCTAGAGTTTCTGATCAGAGGTTCATTGAAGTTTTTGATGTTTCTGCCTTAAAACCATCTTCCCATGACTCTTCCTAG | 591 | 46.87 | MCRSDEVDAVDHRLSLLSEVRLPATPGDDSDGDGDALFIPPLNFSAVDAGIFRSGFPHDANFSFIQTLGLRSIIYLCPEPYPDSNMEFLKSNGIKLYQFGIEGHKEPFVNIPENKIREALRVVLDSRNHPLLIHCKRGKHRTGCLVGCLRKMQRWCLSSVFSEYQRFAAAKARVSDQRFIEVFDVSALKPSSHDSS | 196 |
Gff information
| Chromosome | Start | End | Strand | Old_gene | Gene | Num |
|---|---|---|---|---|---|---|
| 15 | 12184162 | 12185720 | + | Bpe001106.1 | Bpe15g00169 | 115848 |
Annotation
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Bpe15g00169 | 196 | CDD | PFA-DSP_Siw14 | 37 | 184 | - | - | |
| Bpe15g00169 | 196 | Pfam | Tyrosine phosphatase family | 39 | 193 | IPR004861 | - | |
| Bpe15g00169 | 196 | Gene3D | Protein tyrosine phosphatase superfamily | 37 | 187 | IPR029021 | - | |
| Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 94 | 108 | IPR020428 | GO:0016791 | |
| Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 111 | 125 | IPR020428 | GO:0016791 | |
| Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 75 | 88 | IPR020428 | GO:0016791 | |
| Bpe15g00169 | 196 | PRINTS | Plant and fungal dual specificity phosphatase signature | 38 | 55 | IPR020428 | GO:0016791 | |
| Bpe15g00169 | 196 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 39 | 184 | IPR029021 | - | |
| Bpe15g00169 | 196 | PANTHER | - | 22 | 190 | - | - | |
| Bpe15g00169 | 196 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 22 | 190 | - | - | |
| Bpe15g00169 | 196 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 133 | 143 | IPR016130 | GO:0016311|GO:0016791 | |
| Bpe15g00169 | 196 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 43 | 196 | IPR020422 | GO:0006470|GO:0008138 |
Pathway
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Bpe15g00169 | K18045 | SIW14, OCA3; tyrosine-protein phosphatase SIW14 [EC:3.1.3.48] | - | ming:122083976 | 295.434 |
WGDs- Genes
| Select | Gene_1 | Gene_2 | Event_name |
|---|---|---|---|
| Bpe14g00621 | Bpe15g00169 | CCT | |
| Bpe12g00275 | Bpe15g00169 | BCT |
Dupl-types
| Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
|---|---|---|---|---|---|---|
| Bpe14g00621 | Bpe-Chr14:5131870 | Bpe15g00169 | Bpe-Chr15:12184162 | 1.92E-97 | dispersed | |
| Bpe14g00022 | Bpe-Chr14:430444 | Bpe15g00169 | Bpe-Chr15:12184162 | 1.91E-73 | transposed | |
| Bpe12g00275 | Bpe-Chr12:2961721 | Bpe15g00169 | Bpe-Chr15:12184162 | 4.42E-101 | wgd |
Deco-Alignment
| Select | Vvi1 | Blo1 | Blo2 | Bda1 | Bda2 | Bpe1 | Bpe2 | Bma1 | Bma2 | Cmo1 | Cmo2 | Cma1 | Cma2 | Car1 | Car2 | Sed1 | Cpe1 | Cpe2 | Bhi1 | Tan1 | Cmetu1 | Lac1 | Hepe1 | Mch1 | Lcy1 | Cla1 | Cam1 | Cec1 | Cco1 | Clacu1 | Cmu1 | Cre1 | Cone1 | Cone2 | Cone3 | Cone4 | Lsi1 | Csa1 | Chy1 | Cme1 | Blo3 | Blo4 | Bda3 | Bda4 | Bpe3 | Bpe4 | Bma3 | Bma4 | Sed2 | Cmo3 | Cmo4 | Cma3 | Cma4 | Car3 | Car4 | Cpe3 | Cpe4 | Bhi2 | Tan2 | Cmetu2 | Lac2 | Hepe2 | Mch2 | Lcy2 | Cla2 | Cam2 | Cec2 | Cco2 | Clacu2 | Cmu2 | Cre2 | Lsi2 | Csa2 | Chy2 | Cme2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Vvi12g443 | . | . | . | . | Bpe12g00275 | Bpe15g00169 | Bma03g01308 | Bma08g00533 | . | . | Cma02g00065 | Cma20g00235 | Car02g00052 | Car20g00205 | Sed05g1894 | . | . | Bhi05g02097 | Tan02g0134 | Cmetu05g0487 | . | . | . | . | Cla02g01771 | Cam02g1872 | Cec02g1896 | Cco02g1936 | Clacu02g1854 | Cmu02g1800 | . | . | Cone10ag1396 | Cone8ag1552 | . | Lsi10g01569 | . | Chy11g00950 | . | Blo04g01214 | Blo13g00337 | . | Bda15g00865 | Bpe14g00621 | . | . | . | Sed01g0708 | Cmo02g00063 | Cmo20g00254 | . | . | Car11g01620 | . | Cpe16g00749 | . | Bhi10g01060 | Tan05g0690 | Cmetu11g0212 | . | Hepe08g0587 | . | . | . | . | . | . | . | . | . | Lsi11g01669 | Csa06g02393 | . | Cme11g01505 |
Syn-Families
| Select | Gene | Event_type | S_start | S_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|---|
| Bpe12g00294 | . | 42 | 605 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 60.6 | 5.4e-185 | 644.4 | |
| Bpe15g00128 | . | 42 | 471 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 69.3 | 8.9e-172 | 600.5 | |
| Bpe14g00158 | . | 1 | 427 | Protein tyrosine phosphatase (PTP) family | AT5G39400 | 62.3 | 1.6e-150 | 529.3 | |
| Bpe04g01654 | . | 4 | 848 | Protein tyrosine phosphatase (PTP) family | AT3G10550 | 68.0 | 0.0e+00 | 1152.5 | |
| Bpe04g01654 | . | 6 | 850 | Protein tyrosine phosphatase (PTP) family | AT5G04540 | 64.5 | 0.0e+00 | 1081.6 | |
| Bpe12g00460 | . | 73 | 934 | Protein tyrosine phosphatase (PTP) family | AT5G23720 | 61.5 | 7.8e-294 | 1006.5 | |
| Bpe04g01185 | . | 33 | 171 | Protein tyrosine phosphatase (PTP) family | AT3G06110 | 57.6 | 2.3e-42 | 168.7 | |
| Bpe15g00162 | . | 1 | 166 | Protein tyrosine phosphatase (PTP) family | AT2G04550 | 78.1 | 2.5e-71 | 265.0 | |
| Bpe15g01037 | . | 44 | 322 | Protein tyrosine phosphatase (PTP) family | AT3G52180 | 69.9 | 1.2e-115 | 412.9 | |
| Bpe15g01203 | . | 27 | 289 | Protein tyrosine phosphatase (PTP) family | AT3G10940 | 70.8 | 1.8e-111 | 399.1 | |
| Bpe02g01492 | . | 137 | 541 | Protein tyrosine phosphatase (PTP) family | AT3G01510 | 69.3 | 2.2e-177 | 618.6 | |
| Bpe14g00621 | CCT | 15 | 211 | Protein tyrosine phosphatase (PTP) family | AT2G32960 | 55.9 | 1.2e-69 | 260.0 | |
| Bpe12g00275 | BCT,CCT | 3 | 228 | Protein tyrosine phosphatase (PTP) family | AT2G32960 | 56.4 | 3.7e-68 | 255.0 | |
| Bpe15g00169 | BCT,CCT | 34 | 189 | Protein tyrosine phosphatase (PTP) family | AT2G32960 | 63.9 | 1.1e-64 | 243.4 | |
| Bpe14g00022 | . | 17 | 164 | Protein tyrosine phosphatase (PTP) family | AT2G32960 | 52.2 | 3.5e-50 | 195.3 | |
| Bpe11g00633 | . | 1 | 330 | Protein tyrosine phosphatase (PTP) family | AT2G35680 | 57.1 | 3.7e-100 | 361.7 | |
| Bpe02g02223 | . | 6 | 273 | Protein tyrosine phosphatase (PTP) family | AT2G35680 | 53.9 | 5.2e-78 | 288.1 | |
| Bpe14g00621 | CCT | 47 | 211 | Protein tyrosine phosphatase (PTP) family | AT4G03960 | 73.3 | 6.0e-74 | 273.9 | |
| Bpe15g00169 | BCT,CCT | 22 | 189 | Protein tyrosine phosphatase (PTP) family | AT4G03960 | 68.5 | 2.4e-67 | 251.9 | |
| Bpe12g00275 | BCT,CCT | 39 | 228 | Protein tyrosine phosphatase (PTP) family | AT4G03960 | 59.4 | 6.6e-65 | 243.8 | |
| Bpe14g00022 | . | 13 | 168 | Protein tyrosine phosphatase (PTP) family | AT4G03960 | 57.7 | 3.4e-53 | 204.9 | |
| Bpe14g00022 | . | 4 | 203 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 70.5 | 2.5e-83 | 305.1 | |
| Bpe15g00169 | BCT,CCT | 28 | 189 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 61.7 | 1.8e-57 | 219.2 | |
| Bpe14g00621 | CCT | 34 | 205 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 59.3 | 2.6e-56 | 215.3 | |
| Bpe12g00275 | BCT,CCT | 58 | 220 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 61.3 | 8.3e-55 | 210.3 | |
| Bpe04g01698 | . | 1 | 188 | Protein tyrosine phosphatase (PTP) family | AT3G55270 | 64.7 | 2.7e-61 | 233.8 | |
| Bpe14g00158 | . | 1 | 427 | Protein tyrosine phosphatase (PTP) family | AT5G39400 | 62.3 | 1.6e-150 | 529.3 | |
| Bpe12g00294 | . | 32 | 605 | Protein tyrosine phosphatase (PTP) family | AT3G19420 | 68.8 | 1.4e-230 | 795.8 | |
| Bpe15g00128 | . | 34 | 620 | Protein tyrosine phosphatase (PTP) family | AT3G19420 | 65.5 | 4.1e-214 | 741.1 | |
| Bpe12g00294 | . | 42 | 605 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 60.6 | 5.4e-185 | 644.4 | |
| Bpe15g00128 | . | 42 | 471 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 69.3 | 8.9e-172 | 600.5 | |
| Bpe04g01654 | . | 4 | 848 | Protein tyrosine phosphatase (PTP) family | AT3G10550 | 68.0 | 0.0e+00 | 1152.5 | |
| Bpe04g01654 | . | 6 | 850 | Protein tyrosine phosphatase (PTP) family | AT5G04540 | 64.5 | 0.0e+00 | 1081.6 | |
| Bpe11g00849 | . | 4 | 244 | Protein tyrosine phosphatase (PTP) family | AT3G44620 | 56.1 | 1.6e-74 | 276.2 | |
| Bpe07g00217 | . | 19 | 317 | Protein tyrosine phosphatase (PTP) family | AT2G35320 | 61.7 | 1.2e-110 | 396.4 | |
| Bpe03g01015 | . | 1 | 662 | Protein tyrosine phosphatase (PTP) family | AT3G09100 | 69.7 | 4.1e-284 | 973.8 | |
| Bpe03g01015 | . | 5 | 662 | Protein tyrosine phosphatase (PTP) family | AT5G01290 | 65.5 | 7.6e-259 | 889.8 | |
| Bpe03g01015 | . | 87 | 669 | Protein tyrosine phosphatase (PTP) family | AT5G28210 | 57.5 | 7.6e-184 | 640.6 |
Syn-Orthogroups
| Select | Orthogroup | Bda | Bhi | Blo | Bma | Bpe | Cam | Car | Cco | Cec | Chy | Cla | Clacu | Cma | Cme | Cmetu | Cmo | Cmu | Cone | Cpe | Cre | Csa | HCH | Hepe | Lac | Lcy | Lsi | Mch | Sed | Tan | Vvi | Total |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| OG0001007 | 2 | 3 | 3 | 4 | 3 | 2 | 4 | 2 | 2 | 2 | 2 | 2 | 4 | 2 | 2 | 4 | 2 | 4 | 4 | 1 | 2 | 2 | 2 | 2 | 2 | 2 | 2 | 7 | 6 | 2 | 83 |
Transcriptome
| Select | Gene | Chr | Type | da1 | da2 | da3 | da4 | da5 | da6 | da7 | da8 | da9 | da10 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Bpe15g00169 | Bpe_Chr15 | FPKM | 20.103594 | 21.428429 | 9.015435 | 8.828111 | 11.625514 | 9.698389 | 13.183698 | 8.571865 | 10.538835 | 11.55074 |