Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bpe15g00424 ATGAATGATCTAATGACAAAATCGTTCTTAAGTTATGTGGAATTGAAGAAACAAGCAGTGAAAGACATGGAAGCCGATCCCGACATAGAAACAGTCCAACTCAATCCTGCAGTTGAACATAATCTCTCCAAGTTCTTTCAAGAAGCGGGCCAAGTCAAAACTGAAATGGAAGAGATCAGCAATCTCTTGATCGAACTTCAAACACTCAATGAGGAGGCGAAGTCCATTTTCAGCGCCAAGATTCTTGGTGGGCTAAGAGATCGAATGGATTCAAACGTGGTTTCAATCCTTCGCAAAGCAAAGACGGCAAAGTCTAGGCTGGAAGCGCTCGATCGATCAAACGAAAAAAATCGAAGAAATTCAGAAGCTTTTAAAGAAAGCAGTCATGTTGACAGAACTAGGATTTCTGTCACTAACGGTTTAAGAGTCAAGCTGAGAGAATTGATGAATGATTTTCAGTTCTTGAGAGAGAAAATTCTACGTGATCATAAGGAAGACCTAAGGAGGACGTACTACACTGCAACAGGCGAGCAACTGAGTGAGGAAGTGATTGAGAAAATAGTCACGGGGGGCGAGAGAATTGACTTATTTCAAGGTAATAAAGCCAAGCACCAGGCTGTTTTAGAGGTTCAGAGAAGCTTGAGCAAGCTTCATCAGGTTTTTCTCGACATGGGTGCGCTTGTTGAGACGCAGGGAGAAAAAATGAATGATATTGAGGAGAATGTAGCTAATGCAAGAGGCTTCATCAATGGCGGAACTAATAGTCTTTACTATGCCAATCAGACTAAGAAAAACAAGAAATGGGCGTACTGGGTTGCAGCTGTTGTACTGATCATAGTGCTGGTTTGCTTCATTGCTACACTAGTTTCTTGA 873 41.81 MNDLMTKSFLSYVELKKQAVKDMEADPDIETVQLNPAVEHNLSKFFQEAGQVKTEMEEISNLLIELQTLNEEAKSIFSAKILGGLRDRMDSNVVSILRKAKTAKSRLEALDRSNEKNRRNSEAFKESSHVDRTRISVTNGLRVKLRELMNDFQFLREKILRDHKEDLRRTYYTATGEQLSEEVIEKIVTGGERIDLFQGNKAKHQAVLEVQRSLSKLHQVFLDMGALVETQGEKMNDIEENVANARGFINGGTNSLYYANQTKKNKKWAYWVAAVVLIIVLVCFIATLVS 290
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
15 15775983 15776855 + Bpe001360.1 Bpe15g00424 116103

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Bpe15g00424 290 Gene3D - 193 290 - -
Bpe15g00424 290 CDD SynN 42 194 IPR006011 GO:0016020
Bpe15g00424 290 PANTHER SYNTAXIN-112 3 286 - -
Bpe15g00424 290 Pfam Syntaxin 44 232 IPR006011 GO:0016020
Bpe15g00424 290 MobiDBLite consensus disorder prediction 108 129 - -
Bpe15g00424 290 Coils Coil 52 72 - -
Bpe15g00424 290 Gene3D - 38 167 - -
Bpe15g00424 290 PANTHER SYNTAXIN 3 286 IPR045242 -
Bpe15g00424 290 CDD SNARE_syntaxin1-like 201 256 - -
Bpe15g00424 290 SUPERFAMILY t-snare proteins 40 252 IPR010989 GO:0016020|GO:0016192
Bpe15g00424 290 Coils Coil 100 120 - -
Bpe15g00424 290 SMART SynN_4 37 164 IPR006011 GO:0016020
Bpe15g00424 290 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 197 259 IPR000727 -
Bpe15g00424 290 SMART tSNARE_6 192 259 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bpe15g00424 K08486 STX1B_2_3; syntaxin 1B/2/3 - qsu:111998859 381.333
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Bpe07g00425 Bpe-Chr7:4783671 Bpe15g00424 Bpe-Chr15:15775983 1.08E-120 dispersed
Bpe15g00424 Bpe-Chr15:15775983 Bpe08g00351 Bpe-Chr8:2103594 1.14E-65 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g990 Blo04g00912 Blo16g00051 . . Bpe15g00424 . . . . . Cma03g00740 . Car03g00676 . Sed14g1127 . Cpe10g00620 Bhi03g01315 Tan03g1990 Cmetu08g1065 . Hepe04g1076 . . . . . . . . . . . . . . . . . . . Bda11g01860 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Csa06g03248 Chy02g00640 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bpe02g01227 . 1 339 SNARE and Associated Proteins AT3G24350 65.7 2.7e-104 375.6
Bpe14g00562 . 444 797 SNARE and Associated Proteins AT3G24350 60.2 4.0e-100 361.7
Bpe15g00424 . 1 290 SNARE and Associated Proteins AT2G18260 55.0 1.3e-80 296.6
Bpe07g00425 . 1 293 SNARE and Associated Proteins AT2G18260 51.2 2.6e-76 282.3
Bpe04g01486 . 1269 1525 SNARE and Associated Proteins AT3G11820 80.9 1.2e-113 406.4
Bpe03g01190 . 22 278 SNARE and Associated Proteins AT3G11820 79.0 1.1e-111 399.8
Bpe04g00619 . 19 279 SNARE and Associated Proteins AT3G11820 74.7 5.0e-107 384.4
Bpe02g00700 . 19 279 SNARE and Associated Proteins AT3G11820 70.1 1.9e-98 355.9
Bpe08g00351 . 36 286 SNARE and Associated Proteins AT3G11820 66.1 8.3e-94 340.5
Bpe01g00396 . 36 286 SNARE and Associated Proteins AT3G11820 65.7 7.0e-93 337.4
Bpe04g01486 . 1276 1525 SNARE and Associated Proteins AT3G52400 69.6 3.5e-90 328.6
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT3G52400 61.9 7.3e-88 320.9
Bpe03g01190 . 29 278 SNARE and Associated Proteins AT3G52400 66.4 1.6e-87 319.7
Bpe02g00700 . 1 279 SNARE and Associated Proteins AT3G52400 60.8 6.9e-86 314.3
Bpe08g00351 . 6 286 SNARE and Associated Proteins AT3G52400 56.4 3.0e-81 298.9
Bpe01g00396 . 6 286 SNARE and Associated Proteins AT3G52400 55.7 4.3e-80 295.0
Bpe01g00396 . 6 304 SNARE and Associated Proteins AT4G03330 66.9 3.7e-107 384.8
Bpe08g00351 . 6 304 SNARE and Associated Proteins AT4G03330 66.6 1.4e-106 382.9
Bpe04g01486 . 1248 1525 SNARE and Associated Proteins AT4G03330 58.4 2.0e-84 309.3
Bpe03g01190 . 29 278 SNARE and Associated Proteins AT4G03330 58.0 6.6e-80 294.3
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT4G03330 55.4 6.2e-78 287.7
Bpe02g00700 . 1 284 SNARE and Associated Proteins AT4G03330 51.7 1.9e-74 276.2
Bpe01g00396 . 6 304 SNARE and Associated Proteins AT1G61290 78.6 2.3e-125 445.3
Bpe08g00351 . 6 308 SNARE and Associated Proteins AT1G61290 77.2 1.6e-123 439.1
Bpe04g01486 . 1248 1519 SNARE and Associated Proteins AT1G61290 62.9 9.1e-90 327.0
Bpe03g01190 . 1 277 SNARE and Associated Proteins AT1G61290 58.9 1.0e-85 313.5
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT1G61290 59.8 1.5e-84 309.7
Bpe02g00700 . 1 294 SNARE and Associated Proteins AT1G61290 53.4 2.1e-78 289.3
Bpe01g00396 . 6 304 SNARE and Associated Proteins AT1G11250 76.3 1.7e-120 429.1
Bpe08g00351 . 6 308 SNARE and Associated Proteins AT1G11250 75.9 2.9e-120 428.3
Bpe04g01486 . 1248 1519 SNARE and Associated Proteins AT1G11250 64.0 1.0e-93 340.1
Bpe03g01190 . 1 278 SNARE and Associated Proteins AT1G11250 59.7 5.2e-90 327.8
Bpe04g00619 . 1 279 SNARE and Associated Proteins AT1G11250 61.3 1.7e-88 322.8
Bpe02g00700 . 1 284 SNARE and Associated Proteins AT1G11250 56.7 9.0e-82 300.4
Bpe07g00604 . 1 232 SNARE and Associated Proteins AT3G03800 59.9 2.3e-64 242.7
Bpe07g00233 BCT 1 263 SNARE and Associated Proteins AT5G16830 63.6 9.6e-78 287.0
Bpe05g00520 BCT 1 263 SNARE and Associated Proteins AT5G16830 62.1 1.5e-75 279.6
Bpe05g00520 BCT 1 274 SNARE and Associated Proteins AT5G46860 69.7 3.3e-83 305.1
Bpe07g00233 BCT 1 274 SNARE and Associated Proteins AT5G46860 70.4 7.3e-83 303.9
Bpe05g00520 BCT 1 257 SNARE and Associated Proteins AT4G17730 65.8 6.5e-76 280.8
Bpe07g00233 BCT 1 257 SNARE and Associated Proteins AT4G17730 64.6 3.2e-75 278.5
Bpe14g01345 . 1 182 SNARE and Associated Proteins AT4G17730 52.6 4.2e-43 171.8
Bpe07g00233 BCT 65 256 SNARE and Associated Proteins AT1G32270 58.3 2.3e-49 193.0
Bpe05g00520 BCT 65 256 SNARE and Associated Proteins AT1G32270 57.3 2.0e-48 189.9
Bpe15g01148 . 5 341 SNARE and Associated Proteins AT5G05760 64.9 3.6e-111 398.3
Bpe02g01227 . 1 339 SNARE and Associated Proteins AT3G24350 65.7 2.7e-104 375.6
Bpe14g00562 . 444 797 SNARE and Associated Proteins AT3G24350 60.2 4.0e-100 361.7
Bpe02g01831 . 1 340 SNARE and Associated Proteins AT5G26980 76.2 1.1e-128 456.4
Bpe02g01831 . 1 338 SNARE and Associated Proteins AT4G02195 63.2 1.2e-103 373.2
Bpe02g01831 . 1 338 SNARE and Associated Proteins AT3G05710 76.0 1.7e-129 459.1
Bpe08g01109 CCT 1 225 SNARE and Associated Proteins AT1G16240 70.4 3.5e-81 298.1
Bpe03g00767 CCT 1 231 SNARE and Associated Proteins AT1G16240 57.7 2.0e-68 255.8
Bpe08g01109 CCT 1 225 SNARE and Associated Proteins AT1G79590 70.4 6.5e-84 307.4
Bpe03g00767 CCT 1 231 SNARE and Associated Proteins AT1G79590 59.8 1.2e-69 260.0
Bpe08g01119 . 58 251 SNARE and Associated Proteins AT1G28490 70.1 1.9e-67 252.3
Bpe11g00552 . 86 276 SNARE and Associated Proteins AT1G28490 66.5 5.1e-65 244.2
Bpe01g00179 . 1 286 SNARE and Associated Proteins AT3G09740 56.1 2.0e-80 295.8
Bpe04g01584 . 547 680 SNARE and Associated Proteins AT3G09740 64.6 2.0e-40 162.9
Bpe01g00179 . 1 286 SNARE and Associated Proteins AT3G45280 55.7 5.4e-78 287.7
Bpe01g00179 . 1 286 SNARE and Associated Proteins AT3G61450 52.6 9.3e-75 276.9
Bpe15g01257 . 65 262 SNARE and Associated Proteins AT1G51740 66.0 2.8e-65 245.4
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002433 5 3 5 4 2 1 2 1 2 2 1 1 2 1 2 1 1 3 2 1 2 3 2 2 1 1 1 2 1 4 61
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Bpe15g00424 Bpe_Chr15 FPKM 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0