Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cam01g1547 ATGAACGATCTGTTTTCCACCGATTCCTTCCGCCGACAGCAGCACCGCCATGACTCCGTCGAGATTCCCGACAACGCGCCGTCGTCAACGACTATCAATCTCAACAGTTTCTTCGACGACGTGGAGTCCGTGAAGGCAGAATTGACGGAGCTCGAACGCCTGTATCGAAGCCTCCAGAATTCTCACGAACAGAGCAAAACTCTTCACAATTCGAAGGCGATTAAGGATCTTCGATCGCGAATGGAATCGGATGTGACTCTGGCTCTGAAGAAGGCTAGGTTTATCAAGCTCCGGTTGGAGGAACTGGACCGGTCCAATGCCGAGAACCGGAATCTTCCTGGTTGTGGCTATGGCTCCTCCGCCGACCGGTCAAGAACTTCCGTCGTCAATGGATTGAGGAAGAAGCTGTGTGATTCGATGGAGAGTTTCAATAGATTGAGAGAGGAGATTTCGTCGACGTATAAGGAGACGATTGAACGAAGGTATTTCACAATTACAGGGGAAAATCCTGATGAGAAGACGGTTGATTTGTTGATCTCTACAGGCGAAAGCGAAACATTCTTGCAAAAAGCAATACAAAAGCAAGGAAGAGGAAGAGTTTTGGAAACAATCCAAGAGATTCAAGAAAGGCATGACGCAGTGAAAGACATAGAGAGGAATTTGAGAGAGCTGCACCAAGTTTTCATGGACATGGCGGTGCTGGTTCAATCTCAGGGGCAGCAGTTGGACGATATCGAGAGCCAAGTGACTCGAGCCAACTCCGCTGTCAAGCGCGGCACCACGGAGCTACAAACTGCAAGATACTACCAGAAAAACACTCGCAAATGGATCTGCATAGGCGTCATCGTTCTCGCACTCATTCTCTTCATCATTATCATCTCCGTCGTCCTTTCCAAGAAGTAG 903 48.73 MNDLFSTDSFRRQQHRHDSVEIPDNAPSSTTINLNSFFDDVESVKAELTELERLYRSLQNSHEQSKTLHNSKAIKDLRSRMESDVTLALKKARFIKLRLEELDRSNAENRNLPGCGYGSSADRSRTSVVNGLRKKLCDSMESFNRLREEISSTYKETIERRYFTITGENPDEKTVDLLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFMDMAVLVQSQGQQLDDIESQVTRANSAVKRGTTELQTARYYQKNTRKWICIGVIVLALILFIIIISVVLSKK 300
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 29025152 29026696 + CaPI482276_01g015470.1 Cam01g1547 118629

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cam01g1547 300 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 31 161 - -
Cam01g1547 300 SMART tSNARE_6 199 266 IPR000727 -
Cam01g1547 300 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 204 266 IPR000727 -
Cam01g1547 300 Pfam Syntaxin 36 239 IPR006011 GO:0016020(InterPro)
Cam01g1547 300 PANTHER SYNTAXIN 36 287 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cam01g1547 300 ProSitePatterns Syntaxin / epimorphin family signature. 210 249 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cam01g1547 300 CDD SynN 34 191 IPR006011 GO:0016020(InterPro)
Cam01g1547 300 Coils Coil 34 68 - -
Cam01g1547 300 Pfam SNARE domain 241 292 IPR000727 -
Cam01g1547 300 Gene3D - 199 298 - -
Cam01g1547 300 MobiDBLite consensus disorder prediction 1 27 - -
Cam01g1547 300 CDD SNARE_syntaxin1-like 203 265 - -
Cam01g1547 300 FunFam Syntaxin 132 197 297 - -
Cam01g1547 300 Gene3D - 32 164 - -
Cam01g1547 300 SMART SynN_4 29 155 IPR006011 GO:0016020(InterPro)
Cam01g1547 300 SUPERFAMILY t-snare proteins 33 259 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cam01g1547 K08486 - - csv:101213199 498.049
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cam01g1547 Cam-Chr1:29025152 Cam10g1787 Cam-Chr10:31950722 4.30E-112 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cam08g1742 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 5.7e-87 318.2
Cam04g0520 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 2.7e-101 365.5
Cam01g2004 . 484 786 SNARE and Associated Proteins AT2G18260 55.2 8.3e-87 317.4
Cam10g1787 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.3e-115 411.8
Cam01g1547 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.2e-103 372.5
Cam03g0557 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.4e-92 336.7
Cam10g1328 . 510 764 SNARE and Associated Proteins AT3G11820 52.9 1.6e-69 260.0
Cam10g1787 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.6e-92 334.7
Cam01g1547 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.0e-86 314.7
Cam03g0557 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cam10g1328 . 512 764 SNARE and Associated Proteins AT3G52400 50.6 3.9e-61 232.3
Cam03g0557 . 1 299 SNARE and Associated Proteins AT4G03330 68.9 8.5e-108 387.1
Cam10g1787 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 2.9e-84 308.9
Cam01g1547 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 2.2e-79 292.7
Cam10g1328 . 501 764 SNARE and Associated Proteins AT4G03330 53.8 8.6e-68 254.2
Cam03g0557 . 1 299 SNARE and Associated Proteins AT1G61290 78.9 2.8e-127 451.8
Cam10g1787 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.5e-91 332.4
Cam01g1547 . 1 297 SNARE and Associated Proteins AT1G61290 56.9 4.1e-86 315.1
Cam10g1328 . 516 764 SNARE and Associated Proteins AT1G61290 50.6 1.4e-62 236.9
Cam03g0557 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 4.8e-124 441.0
Cam10g1787 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.5e-93 339.7
Cam01g1547 . 1 292 SNARE and Associated Proteins AT1G11250 57.5 2.8e-87 318.9
Cam10g1328 . 500 764 SNARE and Associated Proteins AT1G11250 50.6 3.5e-66 248.8
Cam10g1328 . 488 783 SNARE and Associated Proteins AT3G03800 74.3 9.7e-112 400.2
Cam02g0975 . 58 291 SNARE and Associated Proteins AT3G03800 59.8 6.4e-71 264.6
Cam10g1328 . 488 682 SNARE and Associated Proteins AT5G08080 79.6 3.9e-78 288.1
Cam02g0975 . 54 244 SNARE and Associated Proteins AT5G08080 59.7 2.2e-52 202.6
Cam10g0137 . 25 280 SNARE and Associated Proteins AT5G16830 59.5 7.9e-76 280.8
Cam10g0137 . 25 280 SNARE and Associated Proteins AT5G46860 66.0 3.9e-80 295.0
Cam10g0137 . 25 280 SNARE and Associated Proteins AT4G17730 60.9 2.6e-73 272.3
Cam10g0137 . 89 280 SNARE and Associated Proteins AT1G32270 59.9 4.3e-52 202.2
Cam07g0410 . 83 418 SNARE and Associated Proteins AT5G05760 66.2 3.7e-112 401.7
Cam08g1742 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 5.7e-87 318.2
Cam02g1577 . 35 350 SNARE and Associated Proteins AT5G26980 76.3 1.5e-123 439.5
Cam09g0545 . 1 318 SNARE and Associated Proteins AT5G26980 66.5 1.5e-102 369.8
Cam09g0545 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 2.5e-105 379.0
Cam02g1577 . 35 348 SNARE and Associated Proteins AT4G02195 63.9 2.4e-100 362.5
Cam02g1577 . 35 350 SNARE and Associated Proteins AT3G05710 75.4 4.9e-125 444.5
Cam09g0545 . 1 318 SNARE and Associated Proteins AT3G05710 64.0 6.0e-99 357.8
Cam09g1092 . 77 309 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Cam10g0445 . 32 247 SNARE and Associated Proteins AT1G16240 68.5 2.0e-77 285.8
Cam09g1092 . 76 309 SNARE and Associated Proteins AT1G79590 71.4 3.8e-88 321.6
Cam10g0445 . 27 247 SNARE and Associated Proteins AT1G79590 67.4 1.4e-79 293.1
Cam06g0176 . 125 315 SNARE and Associated Proteins AT1G28490 71.7 8.2e-67 250.4
Cam10g2004 . 77 340 SNARE and Associated Proteins AT3G09740 79.7 2.6e-113 405.2
Cam02g2177 . 1 264 SNARE and Associated Proteins AT3G09740 67.8 2.5e-95 345.5
Cam02g2177 . 1 264 SNARE and Associated Proteins AT3G45280 65.5 2.8e-91 332.0
Cam10g2004 . 77 340 SNARE and Associated Proteins AT3G45280 64.4 8.6e-88 320.5
Cam10g2004 . 77 337 SNARE and Associated Proteins AT3G61450 68.2 7.1e-95 344.0
Cam02g2177 . 1 261 SNARE and Associated Proteins AT3G61450 61.4 4.3e-84 308.1
Cam11g0668 . 65 309 SNARE and Associated Proteins AT1G51740 72.1 2.5e-89 325.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62