Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cam02g1577 ATGATTGGCATGCACTCTATCTCAAATCCTTCCACTCCTCCCGAGTTCGAAGAGTTTTGGAATTCTTTCCAACGAGAATTCGAGCTCTTCCTCCCTCTCCCCATGGCGTCGAGGAACCGGACTTTGCTTTTTAGGAAATACAGGGACGCGTTGAGGAGTGTGAGGGTTCCTACCAGCTCGTCGCCTGTTTCTGCATCGCCATCGACTAGCTCTGCCGCTGGTGGCCCGGTGATTGAATTGGTTAGCTCGTCGTTGTTGAATCCCAATCGGTCGTACGCTCCATTAAGTACTGAGGATCCGGGTAATTCAAGTAAGGGTGCTCTTACCGTTGGTCTACCTCCGGCTTGGGTGGATGTATCTGAAGAAATAGCTGCAAATGTGCAGCGTGCACGAGTGAAGATGGTGGAGTTAGCTAAGGCTCATGCAAAGGCTTTAATGCCTTCATTTGGAGATGGTAAAGAGGATCAACGATTAATTGAATCTCTCACACAAGACATAACTAATTTAATCAAGAAATCAGAGAAAGGACTCAAGAGACTCTCTGTAGCCGGACCTTCAGAAGATTCCAATATCAGAAAAAATGTTCAGCGATCTCTTGCCACTGATCTTCAGAACCTTTCCATGGAGCTTCGCAAGAAACAATCAACATATTTAAAGCGGCTACGGCAGCAAAAAGAGGAAGGTCAAGATGGGATTGACATAGAGATGAATCTAAATGGAAATAGATCGAGAATGGAGGACGATGATTTAGAACATATGGTGTTTAATGAGCATCAGATGGCTAAGCTGCGAAAGAGTGAAGCATTCACCGCCGAAAGAGAGAGAGAGATCCAACAAGTTGTAGAATCCGTGAATGAGCTTGCTCAGATCATGAAGGATCTATCTGTACTTGTCATAGACCAGGGTACCATTATCGATAGAATAGATTACAATATTCAAAATGTTGCAACGACCGTCGATGAGGGCCTTAAGCAACTGCAAAAGGCAGAGAGAACACAGAAACAAGGAGGGATGGTGATGTGCGCATCCGTGCTCATTATCATATTCTACAAATTAGACAATCAAGCCTTCAATGCTTCGAAAATGCTGAGTTCTGATTTTGGAGTTCGTTAA 1113 44.56 MIGMHSISNPSTPPEFEEFWNSFQREFELFLPLPMASRNRTLLFRKYRDALRSVRVPTSSSPVSASPSTSSAAGGPVIELVSSSLLNPNRSYAPLSTEDPGNSSKGALTVGLPPAWVDVSEEIAANVQRARVKMVELAKAHAKALMPSFGDGKEDQRLIESLTQDITNLIKKSEKGLKRLSVAGPSEDSNIRKNVQRSLATDLQNLSMELRKKQSTYLKRLRQQKEEGQDGIDIEMNLNGNRSRMEDDDLEHMVFNEHQMAKLRKSEAFTAEREREIQQVVESVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVATTVDEGLKQLQKAERTQKQGGMVMCASVLIIIFYKLDNQAFNASKMLSSDFGVR 370
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 28666951 28673020 - CaPI482276_02g015770.1 Cam02g1577 121319

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cam02g1577 370 SUPERFAMILY t-snare proteins 112 322 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cam02g1577 370 ProSitePatterns Syntaxin / epimorphin family signature. 273 312 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cam02g1577 370 Pfam SNARE domain 303 349 IPR000727 -
Cam02g1577 370 CDD SNARE_syntaxin16 271 328 - -
Cam02g1577 370 SMART tSNARE_6 262 329 IPR000727 -
Cam02g1577 370 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 267 329 IPR000727 -
Cam02g1577 370 FunFam Syntaxin-43 113 321 - -
Cam02g1577 370 PANTHER SYNTAXIN 125 346 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cam02g1577 370 Gene3D - 113 321 - -
Cam02g1577 370 SMART SynN_4 107 222 IPR006011 GO:0016020(InterPro)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cam02g1577 K08489 - - csv:101207998 551.206
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cam02g1577 Cam-Chr2:28666951 Cam09g0545 Cam-Chr9:5464802 9.30E-101 dispersed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g133 . . . . . . . . . . Cma05g01087 Cma12g01045 Car05g00958 Car12g01004 . Cpe07g00878 Cpe11g00890 . . . . . . . Cla02g01497 Cam02g1577 Cec02g1601 Cco02g1642 Clacu02g1560 Cmu02g1513 Cre02g1836 Cone10ag0804 Cone3ag0826 . . . Csa02g00478 . Cme05g01576 . . Bda01g01638 . . . . Bma05g00265 Sed11g0396 Cmo05g01102 Cmo12g01056 . . . . . . Bhi06g01461 Tan08g0631 Cmetu05g1168 . Hepe08g2281 . . . . . . . . . Lsi11g00612 . Chy05g01060 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cam08g1742 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 5.7e-87 318.2
Cam04g0520 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 2.7e-101 365.5
Cam01g2004 . 484 786 SNARE and Associated Proteins AT2G18260 55.2 8.3e-87 317.4
Cam10g1787 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.3e-115 411.8
Cam01g1547 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.2e-103 372.5
Cam03g0557 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.4e-92 336.7
Cam10g1328 . 510 764 SNARE and Associated Proteins AT3G11820 52.9 1.6e-69 260.0
Cam10g1787 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.6e-92 334.7
Cam01g1547 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.0e-86 314.7
Cam03g0557 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cam10g1328 . 512 764 SNARE and Associated Proteins AT3G52400 50.6 3.9e-61 232.3
Cam03g0557 . 1 299 SNARE and Associated Proteins AT4G03330 68.9 8.5e-108 387.1
Cam10g1787 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 2.9e-84 308.9
Cam01g1547 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 2.2e-79 292.7
Cam10g1328 . 501 764 SNARE and Associated Proteins AT4G03330 53.8 8.6e-68 254.2
Cam03g0557 . 1 299 SNARE and Associated Proteins AT1G61290 78.9 2.8e-127 451.8
Cam10g1787 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.5e-91 332.4
Cam01g1547 . 1 297 SNARE and Associated Proteins AT1G61290 56.9 4.1e-86 315.1
Cam10g1328 . 516 764 SNARE and Associated Proteins AT1G61290 50.6 1.4e-62 236.9
Cam03g0557 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 4.8e-124 441.0
Cam10g1787 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.5e-93 339.7
Cam01g1547 . 1 292 SNARE and Associated Proteins AT1G11250 57.5 2.8e-87 318.9
Cam10g1328 . 500 764 SNARE and Associated Proteins AT1G11250 50.6 3.5e-66 248.8
Cam10g1328 . 488 783 SNARE and Associated Proteins AT3G03800 74.3 9.7e-112 400.2
Cam02g0975 . 58 291 SNARE and Associated Proteins AT3G03800 59.8 6.4e-71 264.6
Cam10g1328 . 488 682 SNARE and Associated Proteins AT5G08080 79.6 3.9e-78 288.1
Cam02g0975 . 54 244 SNARE and Associated Proteins AT5G08080 59.7 2.2e-52 202.6
Cam10g0137 . 25 280 SNARE and Associated Proteins AT5G16830 59.5 7.9e-76 280.8
Cam10g0137 . 25 280 SNARE and Associated Proteins AT5G46860 66.0 3.9e-80 295.0
Cam10g0137 . 25 280 SNARE and Associated Proteins AT4G17730 60.9 2.6e-73 272.3
Cam10g0137 . 89 280 SNARE and Associated Proteins AT1G32270 59.9 4.3e-52 202.2
Cam07g0410 . 83 418 SNARE and Associated Proteins AT5G05760 66.2 3.7e-112 401.7
Cam08g1742 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 5.7e-87 318.2
Cam02g1577 . 35 350 SNARE and Associated Proteins AT5G26980 76.3 1.5e-123 439.5
Cam09g0545 . 1 318 SNARE and Associated Proteins AT5G26980 66.5 1.5e-102 369.8
Cam09g0545 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 2.5e-105 379.0
Cam02g1577 . 35 348 SNARE and Associated Proteins AT4G02195 63.9 2.4e-100 362.5
Cam02g1577 . 35 350 SNARE and Associated Proteins AT3G05710 75.4 4.9e-125 444.5
Cam09g0545 . 1 318 SNARE and Associated Proteins AT3G05710 64.0 6.0e-99 357.8
Cam09g1092 . 77 309 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Cam10g0445 . 32 247 SNARE and Associated Proteins AT1G16240 68.5 2.0e-77 285.8
Cam09g1092 . 76 309 SNARE and Associated Proteins AT1G79590 71.4 3.8e-88 321.6
Cam10g0445 . 27 247 SNARE and Associated Proteins AT1G79590 67.4 1.4e-79 293.1
Cam06g0176 . 125 315 SNARE and Associated Proteins AT1G28490 71.7 8.2e-67 250.4
Cam10g2004 . 77 340 SNARE and Associated Proteins AT3G09740 79.7 2.6e-113 405.2
Cam02g2177 . 1 264 SNARE and Associated Proteins AT3G09740 67.8 2.5e-95 345.5
Cam02g2177 . 1 264 SNARE and Associated Proteins AT3G45280 65.5 2.8e-91 332.0
Cam10g2004 . 77 340 SNARE and Associated Proteins AT3G45280 64.4 8.6e-88 320.5
Cam10g2004 . 77 337 SNARE and Associated Proteins AT3G61450 68.2 7.1e-95 344.0
Cam02g2177 . 1 261 SNARE and Associated Proteins AT3G61450 61.4 4.3e-84 308.1
Cam11g0668 . 65 309 SNARE and Associated Proteins AT1G51740 72.1 2.5e-89 325.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003497 3 1 2 2 1 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 4 4 2 46