Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cam04g0520 ATGAACGACTTGATGACCAAATCGTTCACCAGCTATGTGGATCTGAAGAAGGCAGCCATGAAAGATCTCGACCTCGAAGCTGGTTTAGAAATGCCATCGTCCGCTACCGGAGACAACGGTGACATGGGTCTTTTTCTCGAAGAAGCTGAGAAGGTGAAAATGGAGATGGGTTCAATTAGAGAGATTTTAGTTAAACTCCAACAAGCTAATGAGGAGACCAAATCTGCTCACAAACCCGAAACTCTCAAATCGCTTCGTAATACGATCAATGTCGACATTGTCACCGTCCTGAAAAAGGCGCGATCGATCCGATCTCAGCTTGAGGAAATGGACCGTGCCAATGCTGCAAAGAAACGTCTTTCTGGCAGCAAAGAAGGCACTGCCATTTACCGGACGAGAATTGCGGTGACAAACGGGCTGCGGAAGAAGCTAAAGGAATTGATGATGGAGTTTCAGAGCTTGAGGCAGAGGATGATGACGGAGTACAAGGAAACGGTCGGGCGAAGGTATTTCACGGTGACGGGGGAGCATCCGGAGGAGGAGGTGATAGAGAAGATAATATCCAATGGAGGAGAGGAGTTTTTGGGGAGGGCGATAGAGGAGCACGGGCGGGGGAAAGTGGCGGAGACGGTGGTGGAGATACAAGACCGACACGGGGCGGCGAAGGAGATAGAGAAGAGTTTGCTAGAGCTACACCAAGTGTTTTTGGATATGGCAGTGATGGTTGAAGCACAAGGGGAAAAAATGGATGATATTGAACATCATGTGATGAATGCTTCACAATATGTTAGGGATGGGACTAAGGATTTGAAGACTGCAAAAGATTTGCAAAGGAACAGTAGGAAATGTATGTGTTTTGGGATTTTTCTTTTGCTTCTGATTATTTTGGTTGTTGTTATTCCTATTGCTGTTAGTTTTGGAAGTTCTTGA 930 46.34 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEMPSSATGDNGDMGLFLEEAEKVKMEMGSIREILVKLQQANEETKSAHKPETLKSLRNTINVDIVTVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEHPEEEVIEKIISNGGEEFLGRAIEEHGRGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVRDGTKDLKTAKDLQRNSRKCMCFGIFLLLLIILVVVIPIAVSFGSS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 18600528 18601532 + CaPI482276_04g005200.1 Cam04g0520 124598

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cam04g0520 309 CDD SNARE_syntaxin1-like 210 272 - -
Cam04g0520 309 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 39 169 - -
Cam04g0520 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Cam04g0520 309 FunFam Syntaxin 132 204 304 - -
Cam04g0520 309 SMART SynN_4 37 163 IPR006011 GO:0016020(InterPro)
Cam04g0520 309 PANTHER SYNTAXIN 48 294 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cam04g0520 309 Gene3D - 37 166 - -
Cam04g0520 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cam04g0520 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020(InterPro)
Cam04g0520 309 SMART tSNARE_6 206 273 IPR000727 -
Cam04g0520 309 CDD SynN 42 198 IPR006011 GO:0016020(InterPro)
Cam04g0520 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cam04g0520 309 Pfam SNARE domain 248 299 IPR000727 -
Cam04g0520 309 Coils Coil 137 157 - -
Cam04g0520 309 Gene3D - 206 307 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cam04g0520 K08486 - - csv:101220775 565.459
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cam01g2004 Cam-Chr1:33268374 Cam04g0520 Cam-Chr4:18600528 2.30E-56 dispersed
Cam04g0520 Cam-Chr4:18600528 Cam10g1787 Cam-Chr10:31950722 1.10E-59 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cam08g1742 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 5.7e-87 318.2
Cam04g0520 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 2.7e-101 365.5
Cam01g2004 . 484 786 SNARE and Associated Proteins AT2G18260 55.2 8.3e-87 317.4
Cam10g1787 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.3e-115 411.8
Cam01g1547 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.2e-103 372.5
Cam03g0557 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.4e-92 336.7
Cam10g1328 . 510 764 SNARE and Associated Proteins AT3G11820 52.9 1.6e-69 260.0
Cam10g1787 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.6e-92 334.7
Cam01g1547 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.0e-86 314.7
Cam03g0557 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cam10g1328 . 512 764 SNARE and Associated Proteins AT3G52400 50.6 3.9e-61 232.3
Cam03g0557 . 1 299 SNARE and Associated Proteins AT4G03330 68.9 8.5e-108 387.1
Cam10g1787 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 2.9e-84 308.9
Cam01g1547 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 2.2e-79 292.7
Cam10g1328 . 501 764 SNARE and Associated Proteins AT4G03330 53.8 8.6e-68 254.2
Cam03g0557 . 1 299 SNARE and Associated Proteins AT1G61290 78.9 2.8e-127 451.8
Cam10g1787 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.5e-91 332.4
Cam01g1547 . 1 297 SNARE and Associated Proteins AT1G61290 56.9 4.1e-86 315.1
Cam10g1328 . 516 764 SNARE and Associated Proteins AT1G61290 50.6 1.4e-62 236.9
Cam03g0557 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 4.8e-124 441.0
Cam10g1787 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.5e-93 339.7
Cam01g1547 . 1 292 SNARE and Associated Proteins AT1G11250 57.5 2.8e-87 318.9
Cam10g1328 . 500 764 SNARE and Associated Proteins AT1G11250 50.6 3.5e-66 248.8
Cam10g1328 . 488 783 SNARE and Associated Proteins AT3G03800 74.3 9.7e-112 400.2
Cam02g0975 . 58 291 SNARE and Associated Proteins AT3G03800 59.8 6.4e-71 264.6
Cam10g1328 . 488 682 SNARE and Associated Proteins AT5G08080 79.6 3.9e-78 288.1
Cam02g0975 . 54 244 SNARE and Associated Proteins AT5G08080 59.7 2.2e-52 202.6
Cam10g0137 . 25 280 SNARE and Associated Proteins AT5G16830 59.5 7.9e-76 280.8
Cam10g0137 . 25 280 SNARE and Associated Proteins AT5G46860 66.0 3.9e-80 295.0
Cam10g0137 . 25 280 SNARE and Associated Proteins AT4G17730 60.9 2.6e-73 272.3
Cam10g0137 . 89 280 SNARE and Associated Proteins AT1G32270 59.9 4.3e-52 202.2
Cam07g0410 . 83 418 SNARE and Associated Proteins AT5G05760 66.2 3.7e-112 401.7
Cam08g1742 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 5.7e-87 318.2
Cam02g1577 . 35 350 SNARE and Associated Proteins AT5G26980 76.3 1.5e-123 439.5
Cam09g0545 . 1 318 SNARE and Associated Proteins AT5G26980 66.5 1.5e-102 369.8
Cam09g0545 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 2.5e-105 379.0
Cam02g1577 . 35 348 SNARE and Associated Proteins AT4G02195 63.9 2.4e-100 362.5
Cam02g1577 . 35 350 SNARE and Associated Proteins AT3G05710 75.4 4.9e-125 444.5
Cam09g0545 . 1 318 SNARE and Associated Proteins AT3G05710 64.0 6.0e-99 357.8
Cam09g1092 . 77 309 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Cam10g0445 . 32 247 SNARE and Associated Proteins AT1G16240 68.5 2.0e-77 285.8
Cam09g1092 . 76 309 SNARE and Associated Proteins AT1G79590 71.4 3.8e-88 321.6
Cam10g0445 . 27 247 SNARE and Associated Proteins AT1G79590 67.4 1.4e-79 293.1
Cam06g0176 . 125 315 SNARE and Associated Proteins AT1G28490 71.7 8.2e-67 250.4
Cam10g2004 . 77 340 SNARE and Associated Proteins AT3G09740 79.7 2.6e-113 405.2
Cam02g2177 . 1 264 SNARE and Associated Proteins AT3G09740 67.8 2.5e-95 345.5
Cam02g2177 . 1 264 SNARE and Associated Proteins AT3G45280 65.5 2.8e-91 332.0
Cam10g2004 . 77 340 SNARE and Associated Proteins AT3G45280 64.4 8.6e-88 320.5
Cam10g2004 . 77 337 SNARE and Associated Proteins AT3G61450 68.2 7.1e-95 344.0
Cam02g2177 . 1 261 SNARE and Associated Proteins AT3G61450 61.4 4.3e-84 308.1
Cam11g0668 . 65 309 SNARE and Associated Proteins AT1G51740 72.1 2.5e-89 325.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32