Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cam05g0797 ATGGCTCTCGACGCCGAAGCTGCACCAGCGGCGGAGTTGGCGCTTGCTGATACCGACATCAACTGGAACAGGTTGGACAAGACAAAGTTTCATATAATTGGGGCAATACTCTTTACGGCTCAGTCAGCCTTGTTACATCCAACAGCGGTTGTAAAAACTAGAATGCAAGTTGCTGGGTCTGGTCTATCTCACATGCGTGGACTGTCAGTTTTCTGGAATATATTGAAGTCTGATGGAATCTCTGGCTTGTATAGAGGTTTTGGTACTTCAGCGATTGGATCATTACCTGGTAGAGTATTGGCTTTAACATCACTAGAAGTATCAAAAGACATGATGTTGAAATATACTGGAAATTTGGAGATGTATGAAGCAACACGTGTTGGTCTTGCTAATGGAGTGGCAGGCATGATCTCGAATTTAGTTTCATGCATATACTATGTGCCATTGGACGTGACTTGCCAGAGGCTGATGGTTCAAGGGCTTCCTGGAACCACCTTCTGCAATGGCCCACTTGATGTTGTCAGAAAAGTGATGAAGGCTGAAGGATTTCGTGGTTTATATAGGGGTTTTGGATTAACGGCTGTAACTCAGTCCCCAGCATCTGCTCTCTGGTGGGGTGTTTATGGTGCTGCTCAGCATATTATCTGGAGGAGCTTAGGATATCAAGATAGCATGGAGAAGAAACCTTCTCACATGGAGATGGTGACGGTTCAGGCCACAGCAGGAATGGTGGCAGGTGCTTGTTCCTCTGTTATTACAACTCCCGTAGACACAGTAAAGACGCGACTTCAGGTCATCGATAACTATGGAATTGGAAGACCATCCGTGCTCAAGACTTCAAGAGCACTTCTCAAGGAAGATGGATGGTTGGGATTTTATAGAGGCTTTGGACCTCGGTTTTTGAATATGTCACTTTATGGAACCACGATGATAGTCACTTATGAACTGATCAAGAGACTTTCCTTAAAGGACATCGTGACATCTTGA 987 44.88 MALDAEAAPAAELALADTDINWNRLDKTKFHIIGAILFTAQSALLHPTAVVKTRMQVAGSGLSHMRGLSVFWNILKSDGISGLYRGFGTSAIGSLPGRVLALTSLEVSKDMMLKYTGNLEMYEATRVGLANGVAGMISNLVSCIYYVPLDVTCQRLMVQGLPGTTFCNGPLDVVRKVMKAEGFRGLYRGFGLTAVTQSPASALWWGVYGAAQHIIWRSLGYQDSMEKKPSHMEMVTVQATAGMVAGACSSVITTPVDTVKTRLQVIDNYGIGRPSVLKTSRALLKEDGWLGFYRGFGPRFLNMSLYGTTMIVTYELIKRLSLKDIVTS 328
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
5 7049466 7052675 + CaPI482276_05g007970.1 Cam05g0797 126201

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cam05g0797 328 Pfam Mitochondrial carrier protein 32 115 IPR018108 -
Cam05g0797 328 Pfam Mitochondrial carrier protein 130 216 IPR018108 -
Cam05g0797 328 Pfam Mitochondrial carrier protein 237 322 IPR018108 -
Cam05g0797 328 PANTHER MITOCHONDRIAL SUBSTRATE CARRIER FAMILY PROTEIN J 7 324 - -
Cam05g0797 328 ProSiteProfiles Solute carrier (Solcar) repeat profile. 26 111 IPR018108 -
Cam05g0797 328 SUPERFAMILY Mitochondrial carrier 23 316 IPR023395 -
Cam05g0797 328 Gene3D Mitochondrial carrier domain 119 324 IPR023395 -
Cam05g0797 328 ProSiteProfiles Solute carrier (Solcar) repeat profile. 126 214 IPR018108 -
Cam05g0797 328 ProSiteProfiles Solute carrier (Solcar) repeat profile. 233 320 IPR018108 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cam05g0797 K15121 - - csv:101213375 617.846
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cam05g0797 Cam-Chr5:7049466 Cam11g0513 Cam-Chr11:6559526 1.70E-82 dispersed
Cam05g0797 Cam-Chr5:7049466 Cam09g0080 Cam-Chr9:1669681 6.20E-64 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cam03g0164 . 1 451 Chloroplast and Mitochondria Gene Families AT2G28800 61.4 9.1e-140 493.8
Cam08g2219 . 71 430 Chloroplast and Mitochondria Gene Families AT2G28800 55.9 5.4e-100 361.7
Cam08g1130 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 3.7e-120 427.9
Cam02g0291 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.0e-142 503.1
Cam02g1907 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 6.6e-121 430.6
Cam01g2494 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 3.3e-120 428.3
Cam01g2495 . 46 309 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.8e-119 425.2
Cam03g0750 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 3.6e-119 424.9
Cam10g1500 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 3.6e-119 424.9
Cam10g0600 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 66.2 8.6e-97 350.5
Cam08g0186 . 109 312 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 6.5e-52 201.4
Cam11g1395 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.9 1.3e-128 456.1
Cam03g1513 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 1.2e-86 316.6
Cam06g1755 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 8.3e-64 240.7
Cam09g2098 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.6e-90 327.4
Cam04g0726 . 3 285 Chloroplast and Mitochondria Gene Families AT3G08940 81.7 9.4e-133 469.9
Cam10g2163 . 2 267 Chloroplast and Mitochondria Gene Families AT3G08940 84.3 2.2e-126 448.7
Cam11g1928 . 37 332 Chloroplast and Mitochondria Gene Families AT1G76570 73.6 2.2e-130 462.2
Cam03g1232 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.8 7.8e-137 483.4
Cam02g0291 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.9e-144 508.1
Cam01g2494 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 9.9e-121 429.9
Cam01g2495 . 49 309 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 4.9e-120 427.6
Cam02g1907 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.4e-120 427.2
Cam03g0750 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 1.9e-119 425.6
Cam10g1500 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.5 1.2e-118 422.9
Cam10g0600 . 6 265 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 3.4e-97 351.7
Cam08g0186 . 109 312 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.4e-52 201.8
Cam02g0291 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.6e-125 446.0
Cam01g2494 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.5e-102 367.9
Cam01g2495 . 49 281 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.6e-101 366.3
Cam02g1907 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 4.7e-101 364.8
Cam03g0750 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 8.0e-101 364.0
Cam10g1500 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.4 1.0e-100 363.6
Cam10g0600 . 6 237 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 4.9e-82 301.6
Cam08g0186 . 109 296 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.5e-43 173.7
Cam04g0726 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.2 1.3e-66 249.6
Cam10g2163 . 2 164 Chloroplast and Mitochondria Gene Families AT2G40100 67.9 1.1e-60 229.9
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.7e-136 482.3
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 2.9e-136 481.5
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 3.8e-136 481.1
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 6.5e-136 480.3
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.9 5.5e-127 450.7
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.3e-116 414.8
Cam10g0600 . 12 265 Chloroplast and Mitochondria Gene Families AT1G29930 67.1 2.7e-94 342.0
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 6.5e-136 480.3
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 1.1e-135 479.6
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.4e-135 479.2
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.5e-135 478.4
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.9 7.2e-127 450.3
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.0e-116 415.6
Cam10g0600 . 16 265 Chloroplast and Mitochondria Gene Families AT1G29920 68.1 4.7e-94 341.3
Cam08g0186 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 6.8e-53 204.5
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 6.5e-136 480.3
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 1.1e-135 479.6
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.4e-135 479.2
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.5e-135 478.4
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.9 7.2e-127 450.3
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.0e-116 415.6
Cam10g0600 . 16 265 Chloroplast and Mitochondria Gene Families AT1G29910 68.1 4.7e-94 341.3
Cam08g0186 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 6.8e-53 204.5
Cam08g0186 . 47 323 Chloroplast and Mitochondria Gene Families AT4G10340 84.8 3.6e-137 484.6
Cam01g2495 . 81 297 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 3.7e-57 218.8
Cam01g2494 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.3e-57 218.0
Cam03g0750 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.2e-57 217.6
Cam02g1907 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cam10g1500 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cam02g0291 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.9e-54 209.1
Cam10g0600 . 47 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.6e-52 202.2
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.1e-135 479.6
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 5.4e-135 477.2
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.6e-134 475.7
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 2.7e-134 474.9
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.3 1.1e-127 453.0
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 6.7e-117 417.2
Cam10g0600 . 23 265 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 7.9e-94 340.5
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 7.6e-137 483.4
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 2.9e-136 481.5
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 3.8e-136 481.1
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 1.9e-135 478.8
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.6 1.5e-129 459.1
Cam02g0291 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.8e-114 409.1
Cam10g0600 . 35 265 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 8.0e-94 340.5
Cam04g0726 . 2 285 Chloroplast and Mitochondria Gene Families AT5G01530 82.8 1.4e-136 482.6
Cam10g2163 . 2 267 Chloroplast and Mitochondria Gene Families AT5G01530 87.3 1.5e-133 472.6
Cam10g0734 . 140 399 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 2.4e-143 505.0
Cam10g0734 . 93 399 Chloroplast and Mitochondria Gene Families AT3G27240 85.7 1.2e-149 526.2
Cam02g1998 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.3 6.8e-143 503.8
Cam04g0686 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 63.9 2.0e-110 396.0
Cam02g1998 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 3.0e-143 505.0
Cam04g0686 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.2 3.7e-117 418.3
Cam09g0549 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 2.2e-135 478.8
Cam01g0597 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.2 1.9e-110 396.0
Cam01g0597 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 63.4 3.8e-123 438.3
Cam09g0549 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 2.5e-106 382.5
Cam03g0554 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.0 1.4e-260 895.6
Cam02g1782 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.1 2.2e-242 835.1
Cam02g0142 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.7 8.5e-226 780.0
Cam09g0076 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.3 3.2e-62 235.0
Cam06g1010 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 57.9 4.4e-51 198.0
Cam06g1010 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 58.4 5.9e-51 197.6
Cam09g0076 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.5e-41 166.4
Cam09g0076 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.4 4.4e-62 234.6
Cam06g1010 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 57.7 8.2e-53 203.8
Cam05g2511 . 663 837 Chloroplast and Mitochondria Gene Families AT1G26100 69.7 1.5e-67 253.1
Cam11g0556 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 2.1e-90 328.9
Cam09g1308 . 23 230 Chloroplast and Mitochondria Gene Families AT4G25570 69.0 2.3e-83 305.8
Cam01g0688 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 53.2 5.0e-65 244.6
Cam01g0787 . 9 368 Chloroplast and Mitochondria Gene Families AT5G14040 81.2 4.3e-170 594.3
Cam05g1421 . 10 357 Chloroplast and Mitochondria Gene Families AT5G14040 77.2 5.8e-159 557.4
Cam06g1970 . 39 340 Chloroplast and Mitochondria Gene Families AT5G14040 86.4 1.1e-154 543.1
Cam02g0346 . 11 297 Chloroplast and Mitochondria Gene Families AT5G14040 52.1 4.0e-83 305.4
Cam01g0787 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 7.2e-146 513.8
Cam05g1421 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 71.7 3.0e-144 508.4
Cam06g1970 . 10 340 Chloroplast and Mitochondria Gene Families AT3G48850 68.4 5.9e-140 494.2
Cam02g0346 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 2.7e-84 309.3
Cam02g0346 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 5.9e-133 470.7
Cam05g1421 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 52.5 1.5e-88 323.2
Cam01g0787 . 62 366 Chloroplast and Mitochondria Gene Families AT2G17270 51.5 3.5e-85 312.0
Cam11g0513 . 1 299 Chloroplast and Mitochondria Gene Families AT5G15640 77.2 2.2e-130 462.2
Cam05g0797 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.7 1.2e-80 297.0
Cam05g1984 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 66.8 1.1e-124 443.4
Cam09g0080 . 111 454 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 3.7e-104 375.2
Cam09g0080 . 111 458 Chloroplast and Mitochondria Gene Families AT1G72820 76.1 9.6e-148 520.0
Cam05g1984 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 4.8e-131 464.5
Cam01g0241 . 82 286 Chloroplast and Mitochondria Gene Families AT5G52570 52.2 1.3e-50 196.8
Cam05g0997 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.2 1.2e-69 260.0
Cam01g0241 . 69 204 Chloroplast and Mitochondria Gene Families AT4G25700 74.3 1.9e-56 216.1
Cam02g0159 . 149 327 Chloroplast and Mitochondria Gene Families AT4G03320 52.2 8.3e-57 217.6
Cam10g0602 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 6.6e-120 427.6
Cam06g1431 . 53 542 Chloroplast and Mitochondria Gene Families AT2G18710 85.6 1.2e-237 819.3
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002174 2 4 1 1 1 2 3 2 2 2 2 1 4 2 2 3 2 3 3 1 2 2 2 2 2 2 2 2 3 2 64