Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cam06g1755 ATGGCCACTGTCACTACTCAAGCTTCCGCCGCCGTTTTCCGGCCATGCGCCGCCCGATCCAGATTCCTTTCTGGTTCTTCCGGTAAACTCCACCGTGAGCTCTCGGTTAAACCAGTCTCTGCTTCGTCGTCTTCATCTTTCAAGGTTGAAGCCAAGAAGGGAGAATGGTTGCCTGGTCTGCCATCTCCGGCGTACTTAAATGGCAGTCTTCCGGGCGACAATGGATTTGACCCACTGGGTTTAGCGGAAGACCCAGAGAATTTGAGGTGGTTCGTACAAGCGGAGCTGGTGAATGGGCGGTGGGCTATGCTGGGTGTCGCCGGAATGCTTTTGCCGGAGGTTTTCACGAAGATCGGAATTATCAACGCCCCTCAATGGTACGACGCCGGAAAGGCAGAGTACTTCGCCTCATCGTCAACTCTGTTCGTGATCGAGTTTATCCTCTTCCATTACGTCGAAATCCGCAGATGGCAAGACATTAAAAACCCTGGCTGCGTTAACCAAGACCCCATTTTCAAGCAATACAGTTTGCCCCCAAATGAATGTGGTTACCCGGGTGGGATTTTCAATCCCCTGAATTTTGCCCCCACTCTTGAAGCCAAAGAGAAGGAATTAGCCAATGGGAGACTTGCGATGTTGGCGTTCTTGGGATTCATTGTGCAACACAATGTGACAGGGAAGGGGCCATTTGACAACCTATTGCAGCACATTTCAGACCCATGGCACAACACCATTGTCCAGACATTTGGTGGCAACTAA 759 51.12 MATVTTQASAAVFRPCAARSRFLSGSSGKLHRELSVKPVSASSSSSFKVEAKKGEWLPGLPSPAYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQYSLPPNECGYPGGIFNPLNFAPTLEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTFGGN 252
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
6 28793862 28795050 + CaPI482276_06g017550.1 Cam06g1755 130055

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cam06g1755 252 Gene3D Chlorophyll a/b binding protein domain 63 242 - -
Cam06g1755 252 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 16 245 IPR001344 GO:0009416(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Cam06g1755 252 FunFam Chlorophyll a-b binding protein, chloroplastic 63 242 - -
Cam06g1755 252 SUPERFAMILY Chlorophyll a-b binding protein 53 249 - -
Cam06g1755 252 Pfam Chlorophyll A-B binding protein 63 222 IPR022796 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cam06g1755 K08910 - - csv:101222701 496.508
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cam06g1755 Cam-Chr6:28793862 Cam08g2067 Cam-Chr8:26202949 2.60E-54 dispersed
Cam09g2098 Cam-Chr9:35536908 Cam06g1755 Cam-Chr6:28793862 1.00E-39 transposed
Cam11g1395 Cam-Chr11:26609014 Cam06g1755 Cam-Chr6:28793862 1.20E-62 transposed
Cam04g1248 Cam-Chr4:26466273 Cam06g1755 Cam-Chr6:28793862 4.10E-132 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi17g566 Blo04g00773 . Bda06g00542 Bda15g00608 Bpe12g00541 . . Bma12g00994 . . . Cma11g00139 Car10g00187 Car11g00156 . . Cpe04g01495 . . . . . . . Cla06g01586 Cam06g1755 Cec06g1811 Cco06g1814 Clacu06g1721 Cmu06g1664 Cre06g2478 Cone2ag0840 Cone16ag0175 . . Lsi02g00081 Csa01g00560 Chy12g01533 Cme12g01983 Blo13g00003 Blo15g00312 . . Bpe07g00779 . . Bma08g00227 Sed08g2078 Cmo10g00213 Cmo11g00172 . . . . . Cpe18g00788 Bhi08g01147 Tan05g2431 Cmetu02g0368 Lac10g0087 Hepe07g2501 . . Cla04g01190 Cam04g1247 Cec01g1758 Cco01g1804 Clacu04g1276 Cmu04g1254 Cre01g1547 . Csa01g00241 Chy02g02491 Cme02g01877
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cam03g0164 . 1 451 Chloroplast and Mitochondria Gene Families AT2G28800 61.4 9.1e-140 493.8
Cam08g2219 . 71 430 Chloroplast and Mitochondria Gene Families AT2G28800 55.9 5.4e-100 361.7
Cam08g1130 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 3.7e-120 427.9
Cam02g0291 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.0e-142 503.1
Cam02g1907 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 6.6e-121 430.6
Cam01g2494 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 3.3e-120 428.3
Cam01g2495 . 46 309 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.8e-119 425.2
Cam03g0750 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 3.6e-119 424.9
Cam10g1500 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 3.6e-119 424.9
Cam10g0600 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 66.2 8.6e-97 350.5
Cam08g0186 . 109 312 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 6.5e-52 201.4
Cam11g1395 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.9 1.3e-128 456.1
Cam03g1513 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 1.2e-86 316.6
Cam06g1755 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 8.3e-64 240.7
Cam09g2098 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.6e-90 327.4
Cam04g0726 . 3 285 Chloroplast and Mitochondria Gene Families AT3G08940 81.7 9.4e-133 469.9
Cam10g2163 . 2 267 Chloroplast and Mitochondria Gene Families AT3G08940 84.3 2.2e-126 448.7
Cam11g1928 . 37 332 Chloroplast and Mitochondria Gene Families AT1G76570 73.6 2.2e-130 462.2
Cam03g1232 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.8 7.8e-137 483.4
Cam02g0291 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.9e-144 508.1
Cam01g2494 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 9.9e-121 429.9
Cam01g2495 . 49 309 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 4.9e-120 427.6
Cam02g1907 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.4e-120 427.2
Cam03g0750 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 1.9e-119 425.6
Cam10g1500 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.5 1.2e-118 422.9
Cam10g0600 . 6 265 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 3.4e-97 351.7
Cam08g0186 . 109 312 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.4e-52 201.8
Cam02g0291 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.6e-125 446.0
Cam01g2494 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.5e-102 367.9
Cam01g2495 . 49 281 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.6e-101 366.3
Cam02g1907 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 4.7e-101 364.8
Cam03g0750 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 8.0e-101 364.0
Cam10g1500 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.4 1.0e-100 363.6
Cam10g0600 . 6 237 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 4.9e-82 301.6
Cam08g0186 . 109 296 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.5e-43 173.7
Cam04g0726 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.2 1.3e-66 249.6
Cam10g2163 . 2 164 Chloroplast and Mitochondria Gene Families AT2G40100 67.9 1.1e-60 229.9
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.7e-136 482.3
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 2.9e-136 481.5
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 3.8e-136 481.1
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 6.5e-136 480.3
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.9 5.5e-127 450.7
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.3e-116 414.8
Cam10g0600 . 12 265 Chloroplast and Mitochondria Gene Families AT1G29930 67.1 2.7e-94 342.0
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 6.5e-136 480.3
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 1.1e-135 479.6
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.4e-135 479.2
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.5e-135 478.4
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.9 7.2e-127 450.3
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.0e-116 415.6
Cam10g0600 . 16 265 Chloroplast and Mitochondria Gene Families AT1G29920 68.1 4.7e-94 341.3
Cam08g0186 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 6.8e-53 204.5
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 6.5e-136 480.3
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 1.1e-135 479.6
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.4e-135 479.2
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.5e-135 478.4
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.9 7.2e-127 450.3
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.0e-116 415.6
Cam10g0600 . 16 265 Chloroplast and Mitochondria Gene Families AT1G29910 68.1 4.7e-94 341.3
Cam08g0186 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 6.8e-53 204.5
Cam08g0186 . 47 323 Chloroplast and Mitochondria Gene Families AT4G10340 84.8 3.6e-137 484.6
Cam01g2495 . 81 297 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 3.7e-57 218.8
Cam01g2494 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.3e-57 218.0
Cam03g0750 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.2e-57 217.6
Cam02g1907 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cam10g1500 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cam02g0291 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.9e-54 209.1
Cam10g0600 . 47 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.6e-52 202.2
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.1e-135 479.6
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 5.4e-135 477.2
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.6e-134 475.7
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 2.7e-134 474.9
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.3 1.1e-127 453.0
Cam02g0291 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 6.7e-117 417.2
Cam10g0600 . 23 265 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 7.9e-94 340.5
Cam01g2495 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 7.6e-137 483.4
Cam01g2494 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 2.9e-136 481.5
Cam03g0750 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 3.8e-136 481.1
Cam02g1907 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 1.9e-135 478.8
Cam10g1500 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.6 1.5e-129 459.1
Cam02g0291 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.8e-114 409.1
Cam10g0600 . 35 265 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 8.0e-94 340.5
Cam04g0726 . 2 285 Chloroplast and Mitochondria Gene Families AT5G01530 82.8 1.4e-136 482.6
Cam10g2163 . 2 267 Chloroplast and Mitochondria Gene Families AT5G01530 87.3 1.5e-133 472.6
Cam10g0734 . 140 399 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 2.4e-143 505.0
Cam10g0734 . 93 399 Chloroplast and Mitochondria Gene Families AT3G27240 85.7 1.2e-149 526.2
Cam02g1998 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.3 6.8e-143 503.8
Cam04g0686 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 63.9 2.0e-110 396.0
Cam02g1998 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 3.0e-143 505.0
Cam04g0686 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.2 3.7e-117 418.3
Cam09g0549 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 2.2e-135 478.8
Cam01g0597 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.2 1.9e-110 396.0
Cam01g0597 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 63.4 3.8e-123 438.3
Cam09g0549 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 2.5e-106 382.5
Cam03g0554 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.0 1.4e-260 895.6
Cam02g1782 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.1 2.2e-242 835.1
Cam02g0142 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.7 8.5e-226 780.0
Cam09g0076 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.3 3.2e-62 235.0
Cam06g1010 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 57.9 4.4e-51 198.0
Cam06g1010 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 58.4 5.9e-51 197.6
Cam09g0076 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.5e-41 166.4
Cam09g0076 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.4 4.4e-62 234.6
Cam06g1010 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 57.7 8.2e-53 203.8
Cam05g2511 . 663 837 Chloroplast and Mitochondria Gene Families AT1G26100 69.7 1.5e-67 253.1
Cam11g0556 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 2.1e-90 328.9
Cam09g1308 . 23 230 Chloroplast and Mitochondria Gene Families AT4G25570 69.0 2.3e-83 305.8
Cam01g0688 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 53.2 5.0e-65 244.6
Cam01g0787 . 9 368 Chloroplast and Mitochondria Gene Families AT5G14040 81.2 4.3e-170 594.3
Cam05g1421 . 10 357 Chloroplast and Mitochondria Gene Families AT5G14040 77.2 5.8e-159 557.4
Cam06g1970 . 39 340 Chloroplast and Mitochondria Gene Families AT5G14040 86.4 1.1e-154 543.1
Cam02g0346 . 11 297 Chloroplast and Mitochondria Gene Families AT5G14040 52.1 4.0e-83 305.4
Cam01g0787 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 7.2e-146 513.8
Cam05g1421 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 71.7 3.0e-144 508.4
Cam06g1970 . 10 340 Chloroplast and Mitochondria Gene Families AT3G48850 68.4 5.9e-140 494.2
Cam02g0346 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 2.7e-84 309.3
Cam02g0346 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 5.9e-133 470.7
Cam05g1421 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 52.5 1.5e-88 323.2
Cam01g0787 . 62 366 Chloroplast and Mitochondria Gene Families AT2G17270 51.5 3.5e-85 312.0
Cam11g0513 . 1 299 Chloroplast and Mitochondria Gene Families AT5G15640 77.2 2.2e-130 462.2
Cam05g0797 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.7 1.2e-80 297.0
Cam05g1984 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 66.8 1.1e-124 443.4
Cam09g0080 . 111 454 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 3.7e-104 375.2
Cam09g0080 . 111 458 Chloroplast and Mitochondria Gene Families AT1G72820 76.1 9.6e-148 520.0
Cam05g1984 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 4.8e-131 464.5
Cam01g0241 . 82 286 Chloroplast and Mitochondria Gene Families AT5G52570 52.2 1.3e-50 196.8
Cam05g0997 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.2 1.2e-69 260.0
Cam01g0241 . 69 204 Chloroplast and Mitochondria Gene Families AT4G25700 74.3 1.9e-56 216.1
Cam02g0159 . 149 327 Chloroplast and Mitochondria Gene Families AT4G03320 52.2 8.3e-57 217.6
Cam10g0602 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 6.6e-120 427.6
Cam06g1431 . 53 542 Chloroplast and Mitochondria Gene Families AT2G18710 85.6 1.2e-237 819.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001994 2 2 3 3 2 2 3 2 2 2 2 2 3 2 2 3 2 2 3 2 2 2 2 2 2 2 2 3 2 1 66