Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Car04g02735 CAGCTGAAATTGGCTTCGAATTTGCCCACGATTTCCTCTATTGAAGATCCTAATACTCCAATTCTTTCCCCCACTATCTCATCAACTGAAGAACCAATGGCGGTTCCCGCGGTTCAGTTCCCGATCTTCATGGCCGTGAGAGTGCTCGGGATGGTTGTGGCAACTCTCGTCTTCATTTGGACCTTGCACTTCCGTGGAGGATTGGCGCTTATATCAGATAACAAGGATCTCATCTTCAATGTCCATCCTGTTCTTATGGTCATTGGACTCATACTTCTAAATGGTGAAGCAATGTTGGCATACAAGACAGTCTCAGGAACCAAAAATTTCAGAAAACTAGTTCATCTTGCAGTACAGTTTGTTGCATTCTGTTTAAGCCTGATTGGCATATGGGCTGCCCTGAAGTTCCACAACGACAAAGGAATCGAGAACTTTTACAGTTTGCATTCATGGTTGGGTCTAGTTTCGATCTTTCTGTTCGGCTTCCAGTGGACTGCAGGATTTGTAACCTTTTGGTACCCAGGCGGCTCCAGAAACAGCAGATCGACTCTATTGCCATGGCATGTTTTCTTTGGTGTTTACATATATGGCCTTTCCATTGCTACAGCTGTTACTGGCTTGTTAGAAAAAGCTACATTTCTTCAAGTTAGCAAGGTGATTTTACGCTATTCCAACGAGGCGTTGCTGTTAAATTCGTTGGGTCTCCTCATTGTTCTTCTGGGTGGTCTTGTAATTCTCGCGGTTATCGCTCCATCGAATGGCAAAGGTGACATTTTCAGGGGGCCATCAGAATAG 795 44.65 QLKLASNLPTISSIEDPNTPILSPTISSTEEPMAVPAVQFPIFMAVRVLGMVVATLVFIWTLHFRGGLALISDNKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKNFRKLVHLAVQFVAFCLSLIGIWAALKFHNDKGIENFYSLHSWLGLVSIFLFGFQWTAGFVTFWYPGGSRNSRSTLLPWHVFFGVYIYGLSIATAVTGLLEKATFLQVSKVILRYSNEALLLNSLGLLIVLLGGLVILAVIAPSNGKGDIFRGPSE 264
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 21142225 21145518 + Carg05919-RA Car04g02735 148160

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Car04g02735 264 ProSiteProfiles Cytochrome b561 domain profile. 45 249 IPR006593 -
Car04g02735 264 Pfam Eukaryotic cytochrome b561 81 213 IPR006593 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Car04g02735 K08360 CYB561; transmembrane ascorbate-dependent reductase [EC:7.2.1.3] - csv:101212633 396.356
       

WGDs- Genes

Select Gene_1 Gene_2 Event_name
Car04g02735 Car15g00204 CST
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Car04g02080 Car-Chr4:16950821 Car04g02735 Car-Chr4:21142225 2.58E-53 dispersed
Car04g02735 Car-Chr4:21142225 Car19g00304 Car-Chr19:4571821 2.55E-42 dispersed
Car15g00204 Car-Chr15:1108665 Car04g02735 Car-Chr4:21142225 3.36E-140 wgd
Car18g00976 Car-Chr18:10297132 Car04g02735 Car-Chr4:21142225 3.25E-41 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g922 . Blo11g00348 . . . . . . . . . . . . . . Cpe13g01013 Bhi06g00326 Tan11g0406 . . . . . Cla11g00506 Cam11g0556 Cec11g0556 Cco11g0544 Clacu11g0678 Cmu11g0538 Cre11g1018 Cone11ag0327 . . . . Csa05g03088 . . . . Bda07g01072 . . Bpe11g01208 . . . Cmo04g02972 Cmo15g00206 Cma04g02842 Cma15g00193 Car04g02735 Car15g00204 . Cpe01g02464 . . . . . . . . . . . . . . Lsi03g00225 . Chy09g00143 Cme09g00161
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Car01g00538 . 1 392 Chloroplast and Mitochondria Gene Families AT2G28800 67.0 1.2e-138 490.3
Car05g00045 . 71 416 Chloroplast and Mitochondria Gene Families AT2G28800 56.4 3.8e-100 362.5
Car12g00041 . 71 423 Chloroplast and Mitochondria Gene Families AT2G28800 53.5 2.2e-95 346.7
Car11g01195 . 6 258 Chloroplast and Mitochondria Gene Families AT1G15820 82.0 2.6e-120 428.7
Car15g00557 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 2.6e-120 428.7
Car01g00812 . 73 276 Chloroplast and Mitochondria Gene Families AT3G27690 52.2 2.0e-52 203.4
Car03g01249 . 62 228 Chloroplast and Mitochondria Gene Families AT3G61470 92.2 2.2e-95 345.9
Car18g00644 . 1 156 Chloroplast and Mitochondria Gene Families AT3G61470 94.2 1.5e-88 323.2
Car11g00625 . 61 266 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 5.4e-86 314.7
Car10g00187 CST 22 250 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 1.0e-63 240.7
Car01g00733 . 284 499 Chloroplast and Mitochondria Gene Families AT3G61470 50.2 7.4e-59 224.6
Car04g02495 CST 1 205 Chloroplast and Mitochondria Gene Families AT3G54890 77.7 4.5e-86 314.7
Car15g00417 CST 5 136 Chloroplast and Mitochondria Gene Families AT3G54890 90.9 3.3e-68 255.4
Car07g01031 . 1 286 Chloroplast and Mitochondria Gene Families AT3G08940 82.0 3.0e-133 471.9
Car03g00315 . 2 196 Chloroplast and Mitochondria Gene Families AT3G08940 78.6 1.8e-85 313.2
Car09g00012 . 1 248 Chloroplast and Mitochondria Gene Families AT1G76570 63.9 9.0e-86 314.3
Car11g00797 . 1 274 Chloroplast and Mitochondria Gene Families AT1G61520 86.9 9.4e-137 483.4
Car10g00793 . 1 260 Chloroplast and Mitochondria Gene Families AT1G61520 75.5 1.1e-113 406.8
Car01g00812 . 73 276 Chloroplast and Mitochondria Gene Families AT2G05070 52.6 1.4e-52 203.8
Car01g00812 . 73 260 Chloroplast and Mitochondria Gene Families AT2G05100 50.8 1.4e-43 174.1
Car03g00315 . 1 169 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 4.8e-68 254.6
Car07g01031 . 4 168 Chloroplast and Mitochondria Gene Families AT2G40100 71.6 1.7e-65 246.1
Car01g00812 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 82.9 4.5e-134 474.6
Car07g01031 . 1 286 Chloroplast and Mitochondria Gene Families AT5G01530 81.4 1.6e-134 476.1
Car03g00315 . 4 196 Chloroplast and Mitochondria Gene Families AT5G01530 77.3 1.0e-85 313.9
Car16g00769 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 4.4e-144 507.7
Car04g00800 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 7.6e-144 506.9
Car16g00769 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.1 3.2e-149 525.0
Car04g00800 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.8 1.2e-148 523.1
Car20g00286 CST 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 74.4 3.4e-141 498.4
Car03g00292 CST 3 303 Chloroplast and Mitochondria Gene Families AT2G30160 65.7 2.6e-112 402.5
Car07g01060 CST 9 310 Chloroplast and Mitochondria Gene Families AT2G30160 66.1 2.2e-111 399.4
Car02g00515 . 5 164 Chloroplast and Mitochondria Gene Families AT2G30160 69.6 1.3e-60 230.7
Car20g00286 CST 1 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.4 8.3e-140 493.8
Car03g00292 CST 3 303 Chloroplast and Mitochondria Gene Families AT1G07030 68.6 2.0e-117 419.5
Car07g01060 CST 5 310 Chloroplast and Mitochondria Gene Families AT1G07030 66.9 7.8e-114 407.5
Car02g00515 . 5 164 Chloroplast and Mitochondria Gene Families AT1G07030 69.1 9.4e-59 224.6
Car17g01010 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 3.1e-136 481.9
Car05g01031 . 1 288 Chloroplast and Mitochondria Gene Families AT2G47490 71.7 2.0e-122 436.0
Car15g00866 . 11 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.3 8.6e-110 394.0
Car15g00866 . 3 363 Chloroplast and Mitochondria Gene Families AT1G25380 62.7 3.2e-124 442.2
Car17g01010 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 63.8 3.9e-106 382.1
Car05g01031 . 11 279 Chloroplast and Mitochondria Gene Families AT1G25380 61.7 1.3e-96 350.5
Car13g00556 . 1 584 Chloroplast and Mitochondria Gene Families AT4G21490 74.0 4.6e-258 887.5
Car02g00106 CCT 2 582 Chloroplast and Mitochondria Gene Families AT4G21490 68.0 1.3e-233 806.2
Car19g00757 CCT 1 551 Chloroplast and Mitochondria Gene Families AT4G21490 64.3 3.4e-213 738.4
Car08g00663 . 4 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.6 2.3e-62 235.7
Car17g00669 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.9 1.9e-61 232.6
Car04g02933 . 5 180 Chloroplast and Mitochondria Gene Families AT1G17530 57.3 1.5e-50 196.4
Car12g00815 . 10 179 Chloroplast and Mitochondria Gene Families AT1G17530 55.8 6.7e-46 181.0
Car04g02933 . 15 184 Chloroplast and Mitochondria Gene Families AT3G04800 59.1 9.3e-51 197.2
Car12g00815 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 53.8 5.3e-46 181.4
Car08g00663 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 1.4e-43 173.3
Car17g00669 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 5.5e-43 171.4
Car17g00669 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.1 4.3e-64 241.5
Car08g00663 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.1 1.2e-63 240.0
Car04g02933 . 5 184 Chloroplast and Mitochondria Gene Families AT1G72750 59.0 9.9e-53 203.8
Car12g00815 . 10 183 Chloroplast and Mitochondria Gene Families AT1G72750 54.8 2.8e-47 185.7
Car18g00976 . 543 734 Chloroplast and Mitochondria Gene Families AT1G26100 64.1 1.8e-67 253.1
Car04g02735 CST 33 258 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 3.3e-90 328.6
Car15g00204 CST 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 68.7 6.8e-88 320.9
Car02g00806 . 23 198 Chloroplast and Mitochondria Gene Families AT4G25570 63.5 5.8e-65 245.0
Car19g00304 . 47 195 Chloroplast and Mitochondria Gene Families AT4G25570 57.1 1.7e-48 190.3
Car15g00765 . 9 364 Chloroplast and Mitochondria Gene Families AT5G14040 81.0 7.5e-169 590.5
Car04g02143 . 9 382 Chloroplast and Mitochondria Gene Families AT5G14040 77.1 1.5e-164 576.2
Car11g01274 . 9 365 Chloroplast and Mitochondria Gene Families AT5G14040 77.0 4.4e-161 564.7
Car10g00018 CST 39 347 Chloroplast and Mitochondria Gene Families AT5G14040 84.6 4.7e-155 544.7
Car11g01419 . 11 164 Chloroplast and Mitochondria Gene Families AT5G14040 55.1 1.0e-45 181.4
Car11g01274 . 11 365 Chloroplast and Mitochondria Gene Families AT3G48850 73.0 4.6e-147 518.1
Car15g00765 . 8 363 Chloroplast and Mitochondria Gene Families AT3G48850 70.7 4.3e-145 511.5
Car10g00018 CST 12 347 Chloroplast and Mitochondria Gene Families AT3G48850 69.6 1.3e-141 500.0
Car04g02143 . 8 381 Chloroplast and Mitochondria Gene Families AT3G48850 67.1 1.6e-139 493.0
Car11g01419 . 11 164 Chloroplast and Mitochondria Gene Families AT3G48850 55.1 2.1e-43 173.7
Car11g01274 . 67 368 Chloroplast and Mitochondria Gene Families AT2G17270 51.5 1.0e-86 317.4
Car15g00765 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 2.5e-85 312.8
Car10g00018 CST 51 348 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 3.6e-84 308.9
Car11g01419 . 8 164 Chloroplast and Mitochondria Gene Families AT2G17270 74.1 1.9e-64 243.4
Car15g00230 CST 16 306 Chloroplast and Mitochondria Gene Families AT5G15640 73.3 4.9e-121 431.4
Car04g02706 CST 16 261 Chloroplast and Mitochondria Gene Families AT5G15640 76.9 1.6e-103 373.2
Car01g01330 CCT 1 341 Chloroplast and Mitochondria Gene Families AT5G26200 66.3 7.9e-125 444.1
Car09g00305 CCT 12 344 Chloroplast and Mitochondria Gene Families AT5G26200 66.7 3.0e-124 442.2
Car17g00662 . 1 342 Chloroplast and Mitochondria Gene Families AT5G26200 58.1 1.6e-104 376.7
Car08g00667 . 1 336 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 5.5e-102 368.2
Car17g00662 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 76.8 1.4e-148 523.1
Car08g00667 . 1 340 Chloroplast and Mitochondria Gene Families AT1G72820 74.2 1.2e-144 510.0
Car01g01330 CCT 1 342 Chloroplast and Mitochondria Gene Families AT1G72820 69.6 1.1e-129 460.3
Car09g00305 CCT 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 2.1e-128 456.1
Car15g01125 . 75 280 Chloroplast and Mitochondria Gene Families AT5G52570 52.4 3.0e-51 199.1
Car16g00091 CST 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 62.8 1.2e-68 256.9
Car18g01178 CST 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 64.0 2.6e-68 255.8
Car15g01125 . 35 197 Chloroplast and Mitochondria Gene Families AT4G25700 61.9 3.0e-56 215.7
Car16g00818 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 1.6e-120 429.9
Car02g00893 . 43 546 Chloroplast and Mitochondria Gene Families AT2G18710 84.5 3.7e-241 831.2
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0006419 2 1 2 0 2 1 2 1 1 1 1 1 2 1 1 2 1 1 2 1 1 1 1 1 1 1 1 2 2 1 38
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Car04g02735 Car_Chr04 FPKM 45.884617 51.084343 5.677163 5.949578 3.678985 3.110306 2.965305 0.200402 0.062122 0.049183