Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Car04g02811 ATGGCGAAGTTCAGGGATAGGACTGAAGATTTTAAAGATGCTGTCCGGCATTGTGCTACTTCTTCAGGGCATAACGAGTCCAAGTTGGCGGCTATTATGGCGTCATTCATCATTCAGAAACCTCGGCAAAGGTCACCTTTCATCAAAGCTGCCCTAAAAACGCTTGAGAGCATTGGCGCTCTTGAAGAGTTTATGTTGAAGCATCAAAAGGACTATGTAGATATGTATCGCACAACAGATCAAGAGAGAGACAATATTGAACATGAGGTAACTGCATTCATCAAAGCATGCCAAGAACAAATCGATATCCTAAAAAACAACATTAATGAGGATGACGCACACTCAAAGAGCTGGCTTGGTGCTAGGATTGATGATGCTAATGCCGATACTATTGCACACAAACATGGGGTGGTTCTAATTTTGAGTGAGAAACTTCATTCAGTAACATCACAATTTGATAAGTTAAGAGCCATTCGGTTTCAAGATATAATAAACAAAGCAGTACCAAGAAGAAAACCCAACCAAGTAAATAAACCACGTTCTGCAAATGCCCCCAACTATAATAATATGGAGCTGAGGGAACCTGATAATTTTGAGCATCAACCTGTCCGAGCCCAACAGCAACTGTTGGACGATGAAACTCGTGCACTTCAGGTTGAGTTGACCAGTCTTCTTGATGCAGTCCAGGAAACAGAAACTAAGATGGTAGAGATGTCTGCTTTAAATCACCTAATGTCTACACATGTTTTGCAGCAAGCACAACAAATCGAATTTCTTTATGAACAGGCTGTTGAAGCTACAAAGAACGTCGAGCTTGGTAATAAAGAACTTGCCCAAGCAATTCAGCGGAATAGCAGCAGTAGAACCTTCCTTCTGCTCTTTCTATTTGTGCTAACATTTTCAATTCTCTTTCTTGATTGGTATAGTTGA 930 40.75 MAKFRDRTEDFKDAVRHCATSSGHNESKLAAIMASFIIQKPRQRSPFIKAALKTLESIGALEEFMLKHQKDYVDMYRTTDQERDNIEHEVTAFIKACQEQIDILKNNINEDDAHSKSWLGARIDDANADTIAHKHGVVLILSEKLHSVTSQFDKLRAIRFQDIINKAVPRRKPNQVNKPRSANAPNYNNMELREPDNFEHQPVRAQQQLLDDETRALQVELTSLLDAVQETETKMVEMSALNHLMSTHVLQQAQQIEFLYEQAVEATKNVELGNKELAQAIQRNSSSRTFLLLFLFVLTFSILFLDWYS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 21462640 21465760 - Carg05995-RA Car04g02811 148236

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Car04g02811 309 SUPERFAMILY t-snare proteins 61 273 IPR010989 GO:0016020|GO:0016192
Car04g02811 309 PANTHER SYNTAXIN-18 5 309 - -
Car04g02811 309 PANTHER SYNTAXIN-18 5 309 - -
Car04g02811 309 MobiDBLite consensus disorder prediction 176 190 - -
Car04g02811 309 MobiDBLite consensus disorder prediction 171 193 - -
Car04g02811 309 Pfam SNARE-complex protein Syntaxin-18 N-terminus 6 86 IPR019529 -
Car04g02811 309 Gene3D - 211 306 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Car04g02811 K08492 STX18; syntaxin 18 - csv:101207161 554.673
       

WGDs- Genes

Select Gene_1 Gene_2 Event_name
Car04g02811 Car15g00129 CST
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Car04g02811 Car-Chr4:21462640 Car15g00129 Car-Chr15:721729 0 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi13g422 . . . . . . . . . . . . . . Sed03g0404 Cpe13g01079 . Bhi04g02346 Tan11g0243 Cmetu03g1342 . Hepe02g3337 . Lcy10g2218 . . . . . . . . . . Cone18ag0421 Lsi03g00333 Csa06g00159 . . . . . . . . . . . Cmo04g03046 Cmo15g00129 Cma04g02924 Cma15g00119 Car04g02811 Car15g00129 . Cpe01g02531 . . . . . . . Cla11g00615 Cam11g0668 Cec11g0667 Cco11g0653 Clacu11g0790 Cmu11g0646 Cre11g1122 . . Chy03g00164 Cme03g00216
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Car05g00589 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 3.1e-103 372.5
Car12g00284 . 8 342 SNARE and Associated Proteins AT3G24350 64.8 4.9e-101 365.2
Car07g01140 . 1 308 SNARE and Associated Proteins AT1G08560 69.0 1.3e-102 370.2
Car03g00212 . 1 312 SNARE and Associated Proteins AT1G08560 68.0 6.3e-97 351.3
Car03g00676 . 36 336 SNARE and Associated Proteins AT2G18260 53.4 3.0e-83 305.8
Car06g00468 . 19 279 SNARE and Associated Proteins AT3G11820 77.4 7.8e-111 397.5
Car14g00335 . 19 256 SNARE and Associated Proteins AT3G11820 81.5 8.4e-105 377.5
Car07g00809 . 21 278 SNARE and Associated Proteins AT3G11820 69.8 6.9e-99 357.8
Car18g00320 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.3e-94 342.8
Car13g00552 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 1.8e-91 333.2
Car14g00978 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 5.7e-69 258.5
Car06g00468 . 1 279 SNARE and Associated Proteins AT3G52400 61.5 5.9e-88 321.6
Car14g00335 . 1 256 SNARE and Associated Proteins AT3G52400 64.9 8.0e-85 311.2
Car07g00809 . 1 277 SNARE and Associated Proteins AT3G52400 59.0 2.3e-84 309.7
Car13g00552 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 1.8e-81 300.1
Car18g00320 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.3e-79 293.9
Car18g00320 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 8.7e-107 384.0
Car13g00552 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.1e-106 383.6
Car06g00468 . 1 284 SNARE and Associated Proteins AT4G03330 56.6 9.6e-82 300.8
Car14g00335 . 1 281 SNARE and Associated Proteins AT4G03330 55.1 7.2e-77 284.6
Car07g00809 . 1 278 SNARE and Associated Proteins AT4G03330 52.5 6.7e-75 278.1
Car14g00978 . 1 285 SNARE and Associated Proteins AT4G03330 52.3 1.4e-69 260.4
Car18g00320 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 5.2e-128 454.5
Car13g00552 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 6.3e-126 447.6
Car06g00468 . 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.3e-91 332.8
Car14g00335 . 1 256 SNARE and Associated Proteins AT1G61290 62.8 8.7e-83 304.3
Car07g00809 . 1 296 SNARE and Associated Proteins AT1G61290 54.5 4.8e-81 298.5
Car18g00320 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 2.8e-126 448.7
Car13g00552 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 3.8e-123 438.3
Car06g00468 . 1 294 SNARE and Associated Proteins AT1G11250 60.2 6.3e-94 341.3
Car14g00335 . 1 256 SNARE and Associated Proteins AT1G11250 63.3 8.2e-86 314.3
Car07g00809 . 1 291 SNARE and Associated Proteins AT1G11250 54.3 3.2e-82 302.4
Car14g00978 . 1 285 SNARE and Associated Proteins AT1G11250 50.5 3.7e-70 262.3
Car14g00978 . 1 308 SNARE and Associated Proteins AT3G03800 73.7 2.4e-117 419.1
Car14g00978 . 1 203 SNARE and Associated Proteins AT5G08080 76.8 1.0e-80 297.0
Car06g00569 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.5e-76 280.8
Car16g01109 CST 1 253 SNARE and Associated Proteins AT5G16830 59.8 2.3e-74 276.2
Car06g00569 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.5e-81 299.3
Car16g01109 CST 1 253 SNARE and Associated Proteins AT5G46860 66.8 3.0e-79 292.4
Car06g00569 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.9e-74 275.8
Car16g01109 CST 1 242 SNARE and Associated Proteins AT4G17730 64.0 1.1e-73 273.9
Car16g01109 CST 65 254 SNARE and Associated Proteins AT1G32270 60.5 8.9e-52 201.4
Car06g00569 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.2e-51 201.1
Car04g01051 . 1 334 SNARE and Associated Proteins AT5G05760 64.8 3.2e-110 395.6
Car04g00154 . 1 342 SNARE and Associated Proteins AT5G05760 56.5 1.4e-94 343.6
Car05g00589 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 3.1e-103 372.5
Car12g00284 . 8 342 SNARE and Associated Proteins AT3G24350 64.8 4.9e-101 365.2
Car12g01004 CST 1 327 SNARE and Associated Proteins AT5G26980 75.2 8.8e-126 447.2
Car05g00958 CST 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.5e-125 446.4
Car17g01008 . 1 320 SNARE and Associated Proteins AT5G26980 66.2 2.3e-102 369.4
Car05g00958 CST 1 330 SNARE and Associated Proteins AT4G02195 64.0 2.0e-106 382.9
Car17g01008 . 1 320 SNARE and Associated Proteins AT4G02195 65.3 8.0e-103 370.9
Car12g01004 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.1e-102 369.0
Car05g00958 CST 1 329 SNARE and Associated Proteins AT3G05710 75.1 5.7e-128 454.5
Car12g01004 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.4e-126 449.9
Car17g01008 . 1 320 SNARE and Associated Proteins AT3G05710 64.0 1.5e-99 360.1
Car01g00980 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.0e-91 332.0
Car16g00895 CCT 21 180 SNARE and Associated Proteins AT1G16240 70.0 1.5e-58 223.4
Car09g00889 CCT,CST 1 137 SNARE and Associated Proteins AT1G16240 67.4 7.2e-45 177.9
Car01g00980 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.7e-90 329.7
Car16g00895 CCT 21 180 SNARE and Associated Proteins AT1G79590 69.4 6.0e-56 214.9
Car09g00889 CCT,CST 1 137 SNARE and Associated Proteins AT1G79590 67.4 1.6e-45 180.3
Car05g00763 . 105 281 SNARE and Associated Proteins AT1G28490 67.8 1.2e-59 226.9
Car17g00040 . 107 261 SNARE and Associated Proteins AT1G28490 67.7 5.8e-51 198.0
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.1e-109 392.5
Car14g00181 . 1 278 SNARE and Associated Proteins AT3G09740 73.6 1.8e-108 389.4
Car17g00563 . 35 298 SNARE and Associated Proteins AT3G09740 67.5 4.3e-94 341.7
Car20g00420 . 33 269 SNARE and Associated Proteins AT3G09740 53.7 3.4e-59 225.7
Car17g00563 . 35 298 SNARE and Associated Proteins AT3G45280 63.8 3.3e-86 315.5
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 4.3e-86 315.1
Car14g00181 . 1 278 SNARE and Associated Proteins AT3G45280 59.8 2.0e-83 306.2
Car20g00420 . 33 269 SNARE and Associated Proteins AT3G45280 51.4 2.3e-55 213.0
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 6.5e-95 344.4
Car14g00181 . 1 275 SNARE and Associated Proteins AT3G61450 65.5 8.0e-93 337.4
Car17g00563 . 35 295 SNARE and Associated Proteins AT3G61450 60.5 2.0e-83 306.2
Car04g02811 CST 65 309 SNARE and Associated Proteins AT1G51740 74.4 5.2e-94 341.3
Car15g00129 CST 65 306 SNARE and Associated Proteins AT1G51740 72.8 1.2e-90 330.1
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0011407 0 1 0 1 0 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 2 1 1 1 30
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Car04g02811 Car_Chr04 FPKM 13.409543 11.932037 19.764286 21.28389 16.716005 19.67494 21.317629 8.307242 7.485868 8.091247