Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Car11g00797 ATGGCCACTCAGGCTCTTGTTTCATCCTCGTCTCTAACCTCTTCAGTGGGCGCTGCCAGACAGCGATTAGGACCAAAGCCCTCCCTTGGTTCCTCCAGAAAGGCCGCTTCTTTCGTTGTTAGAGCTGAAGCCACTCCTCCTGTTAAGCAAGGAGCTAACAGACAATTATGGTTCGCTTCTAAACAAAGTCTTACATATTTGGATGGAAGTCTTCCGGGCGATTACGGGTTCGATCCATTGGGACTATCAGACCCCGAGGGCACAGGAGGGTTCATCGAGCCGAGATGGTTGGCATACGGCGAGGTGATCAACGGGAGGTTTGCGATGTTAGGAGCCGCAGGAGCCATTGCCCCAGAGATCTTTGGATCACTAGGGTTAATCCCACCAGAAACAGCCCTCCCATGGTTCAAAACTGGAGTGATCCCACCAGCAGGAACCTACAACTACTGGGCAGACCCCTACACACTGTTTGTGTTTGAGATGGCTCTAATGGGTTTTGCTGAACACAGAAGATTTCAAGATTGGTACAACCCAGGATCCATGGGAAAGCAATACTTCTTAGGGTTAGAGAAGTTCTTGGGTGGGTCAGGTGACCCTGCTTACCCAGGTGGCCCCTTGTTCAACCCTTTAGGGTTTGGAAAAGATGAGAAATCAATGAAGGAATTGAAGCTGAAGGAGATCAAGAATGGGAGGCTTGCAATGTTGGCTATCTTGGGTTACTTCATACAAGGCCTTGTCACTGGTGTTGGCCCTTACCAAAACCTTTTGGACCATTTGTCTGACCCTGTCAACAACAACGTTTTGACAAGCCTTAAGTTCCACTAG 825 49.33 MATQALVSSSSLTSSVGAARQRLGPKPSLGSSRKAASFVVRAEATPPVKQGANRQLWFASKQSLTYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAAGAIAPEIFGSLGLIPPETALPWFKTGVIPPAGTYNYWADPYTLFVFEMALMGFAEHRRFQDWYNPGSMGKQYFLGLEKFLGGSGDPAYPGGPLFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHLSDPVNNNVLTSLKFH 274
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
11 4703072 4704880 - Carg22685-RA Car11g00797 156750

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Car11g00797 274 Gene3D Chlorophyll a/b binding protein domain 55 273 - -
Car11g00797 274 Pfam Chlorophyll A-B binding protein 65 243 IPR022796 -
Car11g00797 274 PANTHER CHLOROPHYLL A-B BINDING PROTEIN, CHLOROPLASTIC 1 273 - -
Car11g00797 274 SUPERFAMILY Chlorophyll a-b binding protein 53 270 - -
Car11g00797 274 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 1 273 IPR001344 GO:0009765|GO:0016020
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Car11g00797 K08909 LHCA3; light-harvesting complex I chlorophyll a/b binding protein 3 - csv:101202993 528.094
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Car10g00187 Car-Chr10:901163 Car11g00797 Car-Chr11:4703072 6.08E-49 dispersed
Car11g00797 Car-Chr11:4703072 Car12g00507 Car-Chr12:3351210 2.81E-53 dispersed
Car10g00793 Car-Chr10:4359492 Car11g00797 Car-Chr11:4703072 4.57E-154 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Car01g00538 . 1 392 Chloroplast and Mitochondria Gene Families AT2G28800 67.0 1.2e-138 490.3
Car05g00045 . 71 416 Chloroplast and Mitochondria Gene Families AT2G28800 56.4 3.8e-100 362.5
Car12g00041 . 71 423 Chloroplast and Mitochondria Gene Families AT2G28800 53.5 2.2e-95 346.7
Car11g01195 . 6 258 Chloroplast and Mitochondria Gene Families AT1G15820 82.0 2.6e-120 428.7
Car15g00557 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 2.6e-120 428.7
Car01g00812 . 73 276 Chloroplast and Mitochondria Gene Families AT3G27690 52.2 2.0e-52 203.4
Car03g01249 . 62 228 Chloroplast and Mitochondria Gene Families AT3G61470 92.2 2.2e-95 345.9
Car18g00644 . 1 156 Chloroplast and Mitochondria Gene Families AT3G61470 94.2 1.5e-88 323.2
Car11g00625 . 61 266 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 5.4e-86 314.7
Car10g00187 CST 22 250 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 1.0e-63 240.7
Car01g00733 . 284 499 Chloroplast and Mitochondria Gene Families AT3G61470 50.2 7.4e-59 224.6
Car04g02495 CST 1 205 Chloroplast and Mitochondria Gene Families AT3G54890 77.7 4.5e-86 314.7
Car15g00417 CST 5 136 Chloroplast and Mitochondria Gene Families AT3G54890 90.9 3.3e-68 255.4
Car07g01031 . 1 286 Chloroplast and Mitochondria Gene Families AT3G08940 82.0 3.0e-133 471.9
Car03g00315 . 2 196 Chloroplast and Mitochondria Gene Families AT3G08940 78.6 1.8e-85 313.2
Car09g00012 . 1 248 Chloroplast and Mitochondria Gene Families AT1G76570 63.9 9.0e-86 314.3
Car11g00797 . 1 274 Chloroplast and Mitochondria Gene Families AT1G61520 86.9 9.4e-137 483.4
Car10g00793 . 1 260 Chloroplast and Mitochondria Gene Families AT1G61520 75.5 1.1e-113 406.8
Car01g00812 . 73 276 Chloroplast and Mitochondria Gene Families AT2G05070 52.6 1.4e-52 203.8
Car01g00812 . 73 260 Chloroplast and Mitochondria Gene Families AT2G05100 50.8 1.4e-43 174.1
Car03g00315 . 1 169 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 4.8e-68 254.6
Car07g01031 . 4 168 Chloroplast and Mitochondria Gene Families AT2G40100 71.6 1.7e-65 246.1
Car01g00812 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 82.9 4.5e-134 474.6
Car07g01031 . 1 286 Chloroplast and Mitochondria Gene Families AT5G01530 81.4 1.6e-134 476.1
Car03g00315 . 4 196 Chloroplast and Mitochondria Gene Families AT5G01530 77.3 1.0e-85 313.9
Car16g00769 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 4.4e-144 507.7
Car04g00800 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 7.6e-144 506.9
Car16g00769 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.1 3.2e-149 525.0
Car04g00800 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.8 1.2e-148 523.1
Car20g00286 CST 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 74.4 3.4e-141 498.4
Car03g00292 CST 3 303 Chloroplast and Mitochondria Gene Families AT2G30160 65.7 2.6e-112 402.5
Car07g01060 CST 9 310 Chloroplast and Mitochondria Gene Families AT2G30160 66.1 2.2e-111 399.4
Car02g00515 . 5 164 Chloroplast and Mitochondria Gene Families AT2G30160 69.6 1.3e-60 230.7
Car20g00286 CST 1 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.4 8.3e-140 493.8
Car03g00292 CST 3 303 Chloroplast and Mitochondria Gene Families AT1G07030 68.6 2.0e-117 419.5
Car07g01060 CST 5 310 Chloroplast and Mitochondria Gene Families AT1G07030 66.9 7.8e-114 407.5
Car02g00515 . 5 164 Chloroplast and Mitochondria Gene Families AT1G07030 69.1 9.4e-59 224.6
Car17g01010 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 3.1e-136 481.9
Car05g01031 . 1 288 Chloroplast and Mitochondria Gene Families AT2G47490 71.7 2.0e-122 436.0
Car15g00866 . 11 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.3 8.6e-110 394.0
Car15g00866 . 3 363 Chloroplast and Mitochondria Gene Families AT1G25380 62.7 3.2e-124 442.2
Car17g01010 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 63.8 3.9e-106 382.1
Car05g01031 . 11 279 Chloroplast and Mitochondria Gene Families AT1G25380 61.7 1.3e-96 350.5
Car13g00556 . 1 584 Chloroplast and Mitochondria Gene Families AT4G21490 74.0 4.6e-258 887.5
Car02g00106 CCT 2 582 Chloroplast and Mitochondria Gene Families AT4G21490 68.0 1.3e-233 806.2
Car19g00757 CCT 1 551 Chloroplast and Mitochondria Gene Families AT4G21490 64.3 3.4e-213 738.4
Car08g00663 . 4 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.6 2.3e-62 235.7
Car17g00669 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.9 1.9e-61 232.6
Car04g02933 . 5 180 Chloroplast and Mitochondria Gene Families AT1G17530 57.3 1.5e-50 196.4
Car12g00815 . 10 179 Chloroplast and Mitochondria Gene Families AT1G17530 55.8 6.7e-46 181.0
Car04g02933 . 15 184 Chloroplast and Mitochondria Gene Families AT3G04800 59.1 9.3e-51 197.2
Car12g00815 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 53.8 5.3e-46 181.4
Car08g00663 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 1.4e-43 173.3
Car17g00669 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 5.5e-43 171.4
Car17g00669 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.1 4.3e-64 241.5
Car08g00663 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.1 1.2e-63 240.0
Car04g02933 . 5 184 Chloroplast and Mitochondria Gene Families AT1G72750 59.0 9.9e-53 203.8
Car12g00815 . 10 183 Chloroplast and Mitochondria Gene Families AT1G72750 54.8 2.8e-47 185.7
Car18g00976 . 543 734 Chloroplast and Mitochondria Gene Families AT1G26100 64.1 1.8e-67 253.1
Car04g02735 CST 33 258 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 3.3e-90 328.6
Car15g00204 CST 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 68.7 6.8e-88 320.9
Car02g00806 . 23 198 Chloroplast and Mitochondria Gene Families AT4G25570 63.5 5.8e-65 245.0
Car19g00304 . 47 195 Chloroplast and Mitochondria Gene Families AT4G25570 57.1 1.7e-48 190.3
Car15g00765 . 9 364 Chloroplast and Mitochondria Gene Families AT5G14040 81.0 7.5e-169 590.5
Car04g02143 . 9 382 Chloroplast and Mitochondria Gene Families AT5G14040 77.1 1.5e-164 576.2
Car11g01274 . 9 365 Chloroplast and Mitochondria Gene Families AT5G14040 77.0 4.4e-161 564.7
Car10g00018 CST 39 347 Chloroplast and Mitochondria Gene Families AT5G14040 84.6 4.7e-155 544.7
Car11g01419 . 11 164 Chloroplast and Mitochondria Gene Families AT5G14040 55.1 1.0e-45 181.4
Car11g01274 . 11 365 Chloroplast and Mitochondria Gene Families AT3G48850 73.0 4.6e-147 518.1
Car15g00765 . 8 363 Chloroplast and Mitochondria Gene Families AT3G48850 70.7 4.3e-145 511.5
Car10g00018 CST 12 347 Chloroplast and Mitochondria Gene Families AT3G48850 69.6 1.3e-141 500.0
Car04g02143 . 8 381 Chloroplast and Mitochondria Gene Families AT3G48850 67.1 1.6e-139 493.0
Car11g01419 . 11 164 Chloroplast and Mitochondria Gene Families AT3G48850 55.1 2.1e-43 173.7
Car11g01274 . 67 368 Chloroplast and Mitochondria Gene Families AT2G17270 51.5 1.0e-86 317.4
Car15g00765 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 2.5e-85 312.8
Car10g00018 CST 51 348 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 3.6e-84 308.9
Car11g01419 . 8 164 Chloroplast and Mitochondria Gene Families AT2G17270 74.1 1.9e-64 243.4
Car15g00230 CST 16 306 Chloroplast and Mitochondria Gene Families AT5G15640 73.3 4.9e-121 431.4
Car04g02706 CST 16 261 Chloroplast and Mitochondria Gene Families AT5G15640 76.9 1.6e-103 373.2
Car01g01330 CCT 1 341 Chloroplast and Mitochondria Gene Families AT5G26200 66.3 7.9e-125 444.1
Car09g00305 CCT 12 344 Chloroplast and Mitochondria Gene Families AT5G26200 66.7 3.0e-124 442.2
Car17g00662 . 1 342 Chloroplast and Mitochondria Gene Families AT5G26200 58.1 1.6e-104 376.7
Car08g00667 . 1 336 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 5.5e-102 368.2
Car17g00662 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 76.8 1.4e-148 523.1
Car08g00667 . 1 340 Chloroplast and Mitochondria Gene Families AT1G72820 74.2 1.2e-144 510.0
Car01g01330 CCT 1 342 Chloroplast and Mitochondria Gene Families AT1G72820 69.6 1.1e-129 460.3
Car09g00305 CCT 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 2.1e-128 456.1
Car15g01125 . 75 280 Chloroplast and Mitochondria Gene Families AT5G52570 52.4 3.0e-51 199.1
Car16g00091 CST 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 62.8 1.2e-68 256.9
Car18g01178 CST 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 64.0 2.6e-68 255.8
Car15g01125 . 35 197 Chloroplast and Mitochondria Gene Families AT4G25700 61.9 3.0e-56 215.7
Car16g00818 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 1.6e-120 429.9
Car02g00893 . 43 546 Chloroplast and Mitochondria Gene Families AT2G18710 84.5 3.7e-241 831.2
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0005692 2 1 2 1 2 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 39
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Car11g00797 Car_Chr11 FPKM 0.0 0.247002 4.435077 3.312421 15.59866 13.201022 14.172811 0.401836 0.530055 0.513233