Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Car16g00895 ATGTGGGGTCTCACACTATTTTTTCTAAGTCCAAGTTTGTTCTTTCTTGTGGTTTGCAGGTCCGAAAAGGAGATAAATCGACGAAAGGACATGCTTGCTCAGATGAGATCAAAAGTAAACCAGATGGCCTCAACGCTGAACATGTCAAACTTCGCTAACCGCAACAGTTTGCTTGGCCCCGATATGAAATCAGCGGATGTAATGAGCAAAACAGCTGAACTAGACAACCAAGGACTTGTTGGTTTTCAAAGACAAATCATGAAGGAGCAAGATGAAGGTCTTGAAAAGTTGGAGGAGACTATAAGAAGTACAAAACATATTGCTTTGGCAGTTAATGAAGAACTCGATCTTCATACTCGCCTAATTGATGACTTAGACCAGCATGTCGATGTTACAGACTCTCGATTAGCGAGGGTGCAGAAGAGATTGGGAATATTGAACAAGCGAGCAAAGGGGAGCTGCTCTTGCTTGGGAATGCTTCTGTCTGTGGTAGGTATTGTGGGTTTAATTGCTGTCATATGGCTACTCATTCGATACTTGTAA 543 42.36 MWGLTLFFLSPSLFFLVVCRSEKEINRRKDMLAQMRSKVNQMASTLNMSNFANRNSLLGPDMKSADVMSKTAELDNQGLVGFQRQIMKEQDEGLEKLEETIRSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLARVQKRLGILNKRAKGSCSCLGMLLSVVGIVGLIAVIWLLIRYL 180
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
16 7125309 7126953 - Carg22360-RA Car16g00895 164047

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Car16g00895 180 Coils Coil 94 114 - -
Car16g00895 180 Pfam SNARE domain 121 171 IPR000727 -
Car16g00895 180 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 84 146 IPR000727 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Car16g00895 K08503 SYP5; syntaxin of plants SYP5 - csv:101223140 285.419
       

WGDs- Genes


Select Gene_1 Gene_2 Event_name
Car01g00980 Car16g00895 CCT
Car09g00889 Car16g00895 CCT
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Car09g00889 Car-Chr9:5458639 Car16g00895 Car-Chr16:7125309 3.14E-27 dispersed
Car16g00895 Car-Chr16:7125309 Car01g00980 Car-Chr1:9324160 2.14E-85 transposed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi19g583 Blo03g00538 . Bda07g00381 Bda09g00411 . Bpe08g01109 . . Cmo16g00959 . Cma01g01111 Cma09g00975 Car01g00980 Car09g00889 Sed07g2705 Cpe06g00787 Cpe02g00792 Bhi09g01700 Tan01g3132 Cmetu01g0482 . Hepe01g1245 Mch11g1220 . . . . . . . . Cone6ag0041 Cone9ag0047 Cone14ag1185 Cone15ag1202 Lsi02g01877 . . . . . Bda05g00693 . . Bpe03g00767 Bma07g01281 Bma14g00320 . Cmo01g01156 Cmo09g00974 . Cma16g00924 . Car16g00895 Cpe14g00748 . . . . . . . . Cla09g01036 Cam09g1092 Cec09g1092 Cco09g1113 . . Cre09g1057 . . Chy01g01059 Cme01g00994
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Car05g00589 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 3.1e-103 372.5
Car12g00284 . 8 342 SNARE and Associated Proteins AT3G24350 64.8 4.9e-101 365.2
Car07g01140 . 1 308 SNARE and Associated Proteins AT1G08560 69.0 1.3e-102 370.2
Car03g00212 . 1 312 SNARE and Associated Proteins AT1G08560 68.0 6.3e-97 351.3
Car03g00676 . 36 336 SNARE and Associated Proteins AT2G18260 53.4 3.0e-83 305.8
Car06g00468 . 19 279 SNARE and Associated Proteins AT3G11820 77.4 7.8e-111 397.5
Car14g00335 . 19 256 SNARE and Associated Proteins AT3G11820 81.5 8.4e-105 377.5
Car07g00809 . 21 278 SNARE and Associated Proteins AT3G11820 69.8 6.9e-99 357.8
Car18g00320 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.3e-94 342.8
Car13g00552 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 1.8e-91 333.2
Car14g00978 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 5.7e-69 258.5
Car06g00468 . 1 279 SNARE and Associated Proteins AT3G52400 61.5 5.9e-88 321.6
Car14g00335 . 1 256 SNARE and Associated Proteins AT3G52400 64.9 8.0e-85 311.2
Car07g00809 . 1 277 SNARE and Associated Proteins AT3G52400 59.0 2.3e-84 309.7
Car13g00552 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 1.8e-81 300.1
Car18g00320 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.3e-79 293.9
Car18g00320 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 8.7e-107 384.0
Car13g00552 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.1e-106 383.6
Car06g00468 . 1 284 SNARE and Associated Proteins AT4G03330 56.6 9.6e-82 300.8
Car14g00335 . 1 281 SNARE and Associated Proteins AT4G03330 55.1 7.2e-77 284.6
Car07g00809 . 1 278 SNARE and Associated Proteins AT4G03330 52.5 6.7e-75 278.1
Car14g00978 . 1 285 SNARE and Associated Proteins AT4G03330 52.3 1.4e-69 260.4
Car18g00320 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 5.2e-128 454.5
Car13g00552 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 6.3e-126 447.6
Car06g00468 . 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.3e-91 332.8
Car14g00335 . 1 256 SNARE and Associated Proteins AT1G61290 62.8 8.7e-83 304.3
Car07g00809 . 1 296 SNARE and Associated Proteins AT1G61290 54.5 4.8e-81 298.5
Car18g00320 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 2.8e-126 448.7
Car13g00552 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 3.8e-123 438.3
Car06g00468 . 1 294 SNARE and Associated Proteins AT1G11250 60.2 6.3e-94 341.3
Car14g00335 . 1 256 SNARE and Associated Proteins AT1G11250 63.3 8.2e-86 314.3
Car07g00809 . 1 291 SNARE and Associated Proteins AT1G11250 54.3 3.2e-82 302.4
Car14g00978 . 1 285 SNARE and Associated Proteins AT1G11250 50.5 3.7e-70 262.3
Car14g00978 . 1 308 SNARE and Associated Proteins AT3G03800 73.7 2.4e-117 419.1
Car14g00978 . 1 203 SNARE and Associated Proteins AT5G08080 76.8 1.0e-80 297.0
Car06g00569 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.5e-76 280.8
Car16g01109 CST 1 253 SNARE and Associated Proteins AT5G16830 59.8 2.3e-74 276.2
Car06g00569 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.5e-81 299.3
Car16g01109 CST 1 253 SNARE and Associated Proteins AT5G46860 66.8 3.0e-79 292.4
Car06g00569 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.9e-74 275.8
Car16g01109 CST 1 242 SNARE and Associated Proteins AT4G17730 64.0 1.1e-73 273.9
Car16g01109 CST 65 254 SNARE and Associated Proteins AT1G32270 60.5 8.9e-52 201.4
Car06g00569 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.2e-51 201.1
Car04g01051 . 1 334 SNARE and Associated Proteins AT5G05760 64.8 3.2e-110 395.6
Car04g00154 . 1 342 SNARE and Associated Proteins AT5G05760 56.5 1.4e-94 343.6
Car05g00589 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 3.1e-103 372.5
Car12g00284 . 8 342 SNARE and Associated Proteins AT3G24350 64.8 4.9e-101 365.2
Car12g01004 CST 1 327 SNARE and Associated Proteins AT5G26980 75.2 8.8e-126 447.2
Car05g00958 CST 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.5e-125 446.4
Car17g01008 . 1 320 SNARE and Associated Proteins AT5G26980 66.2 2.3e-102 369.4
Car05g00958 CST 1 330 SNARE and Associated Proteins AT4G02195 64.0 2.0e-106 382.9
Car17g01008 . 1 320 SNARE and Associated Proteins AT4G02195 65.3 8.0e-103 370.9
Car12g01004 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.1e-102 369.0
Car05g00958 CST 1 329 SNARE and Associated Proteins AT3G05710 75.1 5.7e-128 454.5
Car12g01004 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.4e-126 449.9
Car17g01008 . 1 320 SNARE and Associated Proteins AT3G05710 64.0 1.5e-99 360.1
Car01g00980 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.0e-91 332.0
Car16g00895 CCT 21 180 SNARE and Associated Proteins AT1G16240 70.0 1.5e-58 223.4
Car09g00889 CCT,CST 1 137 SNARE and Associated Proteins AT1G16240 67.4 7.2e-45 177.9
Car01g00980 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.7e-90 329.7
Car16g00895 CCT 21 180 SNARE and Associated Proteins AT1G79590 69.4 6.0e-56 214.9
Car09g00889 CCT,CST 1 137 SNARE and Associated Proteins AT1G79590 67.4 1.6e-45 180.3
Car05g00763 . 105 281 SNARE and Associated Proteins AT1G28490 67.8 1.2e-59 226.9
Car17g00040 . 107 261 SNARE and Associated Proteins AT1G28490 67.7 5.8e-51 198.0
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.1e-109 392.5
Car14g00181 . 1 278 SNARE and Associated Proteins AT3G09740 73.6 1.8e-108 389.4
Car17g00563 . 35 298 SNARE and Associated Proteins AT3G09740 67.5 4.3e-94 341.7
Car20g00420 . 33 269 SNARE and Associated Proteins AT3G09740 53.7 3.4e-59 225.7
Car17g00563 . 35 298 SNARE and Associated Proteins AT3G45280 63.8 3.3e-86 315.5
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 4.3e-86 315.1
Car14g00181 . 1 278 SNARE and Associated Proteins AT3G45280 59.8 2.0e-83 306.2
Car20g00420 . 33 269 SNARE and Associated Proteins AT3G45280 51.4 2.3e-55 213.0
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 6.5e-95 344.4
Car14g00181 . 1 275 SNARE and Associated Proteins AT3G61450 65.5 8.0e-93 337.4
Car17g00563 . 35 295 SNARE and Associated Proteins AT3G61450 60.5 2.0e-83 306.2
Car04g02811 CST 65 309 SNARE and Associated Proteins AT1G51740 74.4 5.2e-94 341.3
Car15g00129 CST 65 306 SNARE and Associated Proteins AT1G51740 72.8 1.2e-90 330.1
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002063 3 5 2 3 2 1 3 1 2 1 1 1 3 2 2 3 1 4 3 1 2 2 1 2 2 2 1 5 3 1 65
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Car16g00895 Car_Chr16 FPKM 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0