Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Car17g00563 AACCATCTTCCGACCATTTCTATCTCCAAATCTCTGCCTTCTTCTTCTTCTTCTTCTTCCTCCAGCCCTTCTTCTTCTTCTGCATCTGCTCGCGACGCCAAAATGACCGTAATCGATGTCATCTTCCGAGTCGATTCCATTTGCAAGAAATACGAGAAGTATGATGTCGAGAAACAGCGCGAGCTCAATGCTTATGGTGATGATGTTTTTGCTCGCCTCTACGCCGCCGTCGAACTCGAAATCGAAGCCGCTCTCCAGAAATATGAGAGTGCCTGTACGGAGAAGAATAGGGCTGCTGCAGTTGCGATGAACGCTGAGGTTCGGCGGAAGAAGGCCCGATTGATGGATGAAGTTCCCAAGCTTCATAAATTGGCTCGCAAGAAGATTAAAGGGGTTCCGAAAGAAGAGCTTGAGGTCAGAGGTGATCTTGTTCTTGCGCTTGAAGAGAGGATTAAAGCGATTCCAGATGGGAGTACGACAGGCAAACCATCTGGAGGATGGGCCTCCACCTCATCTAACAATATTAAGTTTGATTCAACAACAGATGGACACTTCGAGAGCGAGTATTTCCAACAAAGCGAAGAATCGAGTCAATTTCGACAGGAGTATGATATGCGGAAGATGAAACAGGACGAAGGTCTGGATGTCATATCTGAAGGGTTGGATATGCTGAAAAATCTAGCCCATGATATGAATGAGGAATTGGATAGGCAAGTTCCATTAATTGACGAGATTGACTCAAAGGTAGACAAGGTGACTAATGAGATGAAAAACACCAATGTTAGGCTCAAGCAAACGCTGAATGAGGTGAGATCCAGCCAAAACTTCTGCATCGATATCATTCTTCTCTGTATAATTCTTGGAATCGCTTCTTACTTGTACAATATATTGAGCGGAAATGGTTGA 906 44.7 NHLPTISISKSLPSSSSSSSSSPSSSSASARDAKMTVIDVIFRVDSICKKYEKYDVEKQRELNAYGDDVFARLYAAVELEIEAALQKYESACTEKNRAAAVAMNAEVRRKKARLMDEVPKLHKLARKKIKGVPKEELEVRGDLVLALEERIKAIPDGSTTGKPSGGWASTSSNNIKFDSTTDGHFESEYFQQSEESSQFRQEYDMRKMKQDEGLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDSKVDKVTNEMKNTNVRLKQTLNEVRSSQNFCIDIILLCIILGIASYLYNILSGNG 301
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
17 5227173 5229419 - Carg22595-RA Car17g00563 164935

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Car17g00563 301 ProSitePatterns Syntaxin / epimorphin family signature. 210 249 IPR006012 GO:0005484|GO:0006886|GO:0016020
Car17g00563 301 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 204 266 IPR000727 -
Car17g00563 301 MobiDBLite consensus disorder prediction 155 175 - -
Car17g00563 301 Pfam SNARE domain 241 290 IPR000727 -
Car17g00563 301 Coils Coil 242 269 - -
Car17g00563 301 MobiDBLite consensus disorder prediction 1 29 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Car17g00563 K08506 SYP7; syntaxin of plants SYP7 - csv:101211289 427.943
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Car01g00929 Car-Chr1:8979636 Car17g00563 Car-Chr17:5227173 4.67E-123 dispersed
Car14g00181 Car-Chr14:848935 Car17g00563 Car-Chr17:5227173 1.88E-119 dispersed
Car17g00563 Car-Chr17:5227173 Car20g00420 Car-Chr20:2360490 1.50E-107 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Car05g00589 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 3.1e-103 372.5
Car12g00284 . 8 342 SNARE and Associated Proteins AT3G24350 64.8 4.9e-101 365.2
Car07g01140 . 1 308 SNARE and Associated Proteins AT1G08560 69.0 1.3e-102 370.2
Car03g00212 . 1 312 SNARE and Associated Proteins AT1G08560 68.0 6.3e-97 351.3
Car03g00676 . 36 336 SNARE and Associated Proteins AT2G18260 53.4 3.0e-83 305.8
Car06g00468 . 19 279 SNARE and Associated Proteins AT3G11820 77.4 7.8e-111 397.5
Car14g00335 . 19 256 SNARE and Associated Proteins AT3G11820 81.5 8.4e-105 377.5
Car07g00809 . 21 278 SNARE and Associated Proteins AT3G11820 69.8 6.9e-99 357.8
Car18g00320 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.3e-94 342.8
Car13g00552 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 1.8e-91 333.2
Car14g00978 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 5.7e-69 258.5
Car06g00468 . 1 279 SNARE and Associated Proteins AT3G52400 61.5 5.9e-88 321.6
Car14g00335 . 1 256 SNARE and Associated Proteins AT3G52400 64.9 8.0e-85 311.2
Car07g00809 . 1 277 SNARE and Associated Proteins AT3G52400 59.0 2.3e-84 309.7
Car13g00552 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 1.8e-81 300.1
Car18g00320 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.3e-79 293.9
Car18g00320 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 8.7e-107 384.0
Car13g00552 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.1e-106 383.6
Car06g00468 . 1 284 SNARE and Associated Proteins AT4G03330 56.6 9.6e-82 300.8
Car14g00335 . 1 281 SNARE and Associated Proteins AT4G03330 55.1 7.2e-77 284.6
Car07g00809 . 1 278 SNARE and Associated Proteins AT4G03330 52.5 6.7e-75 278.1
Car14g00978 . 1 285 SNARE and Associated Proteins AT4G03330 52.3 1.4e-69 260.4
Car18g00320 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 5.2e-128 454.5
Car13g00552 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 6.3e-126 447.6
Car06g00468 . 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.3e-91 332.8
Car14g00335 . 1 256 SNARE and Associated Proteins AT1G61290 62.8 8.7e-83 304.3
Car07g00809 . 1 296 SNARE and Associated Proteins AT1G61290 54.5 4.8e-81 298.5
Car18g00320 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 2.8e-126 448.7
Car13g00552 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 3.8e-123 438.3
Car06g00468 . 1 294 SNARE and Associated Proteins AT1G11250 60.2 6.3e-94 341.3
Car14g00335 . 1 256 SNARE and Associated Proteins AT1G11250 63.3 8.2e-86 314.3
Car07g00809 . 1 291 SNARE and Associated Proteins AT1G11250 54.3 3.2e-82 302.4
Car14g00978 . 1 285 SNARE and Associated Proteins AT1G11250 50.5 3.7e-70 262.3
Car14g00978 . 1 308 SNARE and Associated Proteins AT3G03800 73.7 2.4e-117 419.1
Car14g00978 . 1 203 SNARE and Associated Proteins AT5G08080 76.8 1.0e-80 297.0
Car06g00569 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.5e-76 280.8
Car16g01109 CST 1 253 SNARE and Associated Proteins AT5G16830 59.8 2.3e-74 276.2
Car06g00569 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.5e-81 299.3
Car16g01109 CST 1 253 SNARE and Associated Proteins AT5G46860 66.8 3.0e-79 292.4
Car06g00569 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.9e-74 275.8
Car16g01109 CST 1 242 SNARE and Associated Proteins AT4G17730 64.0 1.1e-73 273.9
Car16g01109 CST 65 254 SNARE and Associated Proteins AT1G32270 60.5 8.9e-52 201.4
Car06g00569 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.2e-51 201.1
Car04g01051 . 1 334 SNARE and Associated Proteins AT5G05760 64.8 3.2e-110 395.6
Car04g00154 . 1 342 SNARE and Associated Proteins AT5G05760 56.5 1.4e-94 343.6
Car05g00589 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 3.1e-103 372.5
Car12g00284 . 8 342 SNARE and Associated Proteins AT3G24350 64.8 4.9e-101 365.2
Car12g01004 CST 1 327 SNARE and Associated Proteins AT5G26980 75.2 8.8e-126 447.2
Car05g00958 CST 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.5e-125 446.4
Car17g01008 . 1 320 SNARE and Associated Proteins AT5G26980 66.2 2.3e-102 369.4
Car05g00958 CST 1 330 SNARE and Associated Proteins AT4G02195 64.0 2.0e-106 382.9
Car17g01008 . 1 320 SNARE and Associated Proteins AT4G02195 65.3 8.0e-103 370.9
Car12g01004 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.1e-102 369.0
Car05g00958 CST 1 329 SNARE and Associated Proteins AT3G05710 75.1 5.7e-128 454.5
Car12g01004 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.4e-126 449.9
Car17g01008 . 1 320 SNARE and Associated Proteins AT3G05710 64.0 1.5e-99 360.1
Car01g00980 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.0e-91 332.0
Car16g00895 CCT 21 180 SNARE and Associated Proteins AT1G16240 70.0 1.5e-58 223.4
Car09g00889 CCT,CST 1 137 SNARE and Associated Proteins AT1G16240 67.4 7.2e-45 177.9
Car01g00980 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.7e-90 329.7
Car16g00895 CCT 21 180 SNARE and Associated Proteins AT1G79590 69.4 6.0e-56 214.9
Car09g00889 CCT,CST 1 137 SNARE and Associated Proteins AT1G79590 67.4 1.6e-45 180.3
Car05g00763 . 105 281 SNARE and Associated Proteins AT1G28490 67.8 1.2e-59 226.9
Car17g00040 . 107 261 SNARE and Associated Proteins AT1G28490 67.7 5.8e-51 198.0
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.1e-109 392.5
Car14g00181 . 1 278 SNARE and Associated Proteins AT3G09740 73.6 1.8e-108 389.4
Car17g00563 . 35 298 SNARE and Associated Proteins AT3G09740 67.5 4.3e-94 341.7
Car20g00420 . 33 269 SNARE and Associated Proteins AT3G09740 53.7 3.4e-59 225.7
Car17g00563 . 35 298 SNARE and Associated Proteins AT3G45280 63.8 3.3e-86 315.5
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 4.3e-86 315.1
Car14g00181 . 1 278 SNARE and Associated Proteins AT3G45280 59.8 2.0e-83 306.2
Car20g00420 . 33 269 SNARE and Associated Proteins AT3G45280 51.4 2.3e-55 213.0
Car01g00929 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 6.5e-95 344.4
Car14g00181 . 1 275 SNARE and Associated Proteins AT3G61450 65.5 8.0e-93 337.4
Car17g00563 . 35 295 SNARE and Associated Proteins AT3G61450 60.5 2.0e-83 306.2
Car04g02811 CST 65 309 SNARE and Associated Proteins AT1G51740 74.4 5.2e-94 341.3
Car15g00129 CST 65 306 SNARE and Associated Proteins AT1G51740 72.8 1.2e-90 330.1
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Car17g00563 Car_Chr17 FPKM 0.610801 0.971621 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0