Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cco02g1642 ATGGCGTCGAGGAACCGGACTTTGCTTTTTAGGAAATACAGGGACGCATTGAGGAGTGTGAGAGTTCCTACCAGCTCGTCGCCTGTTTCTGCATCGCCATCGACTAGCTCTGCCGCTGGTGGCCCGGTGATTGAATTGGTTAGCTCGTCGTTGTTGAATCCCAATCGGTCGTACGCTCCATTAAGTACTGAGGATCCGGGTAATTCAAGTAAGGGTGCTCTTACCGTTGGTCTACCTCCGGCTTGGGTGGATGTATCTGAAGAAATAGCTGCAAATGTGCAGCGTGCACGAGTGAAGATGGTGGAGTTAGCTAAGGCTCATGCAAAGGCTTTAATGCCTTCATTTGGAGATGGTAAAGAGGATCAACGATTAATTGAATCTCTCACACAAGACATAACTAATTTAATCAAGAAATCAGAGAAAGGACTCAAGAGACTCTCTGTAGCCGGACCTTCAGAAGATTCCAATATCAGAAAAAATGTTCAGCGATCTCTTGCCACTGATCTTCAGAACCTTTCCATGGAGCTTCGCAAGAAACAATCAACATATTTAAAGCAGCTACGGCAGCAAAAAGAGGAAGGTCAAGATGGGATTGACATAGAGATGAATCTAAATGGAAATAGATCGAGAATGGAGGACGATGATTTAGAACATATGGTATTTAATGAGCATCAGATGGCTAAGCTGCGAAAGAGTGAAGCATTCACCGCCGAGAGAGAGAGAGAGATCCAACAAGTTGTAGACTCCGTGAATGAGCTTGCTCAGATCATGAAGGATCTATCTGTACTTGTCATAGACCAGGGTACCATTATCGATAGAATAGATTACAATATTCAAAATGTTGCAACGACCGTCGATGAGGGCCTTAAGCAACTGCAAAAGGCAGAGAGAACACAGAAACAAGGAGGGATGGTGATGTGCGCATCCGTGCTCATTATCATGTGCTTTGTCATGTTGGTTCTTCTGATCCTTAAAACCATACTATTTTGA 990 44.24 MASRNRTLLFRKYRDALRSVRVPTSSSPVSASPSTSSAAGGPVIELVSSSLLNPNRSYAPLSTEDPGNSSKGALTVGLPPAWVDVSEEIAANVQRARVKMVELAKAHAKALMPSFGDGKEDQRLIESLTQDITNLIKKSEKGLKRLSVAGPSEDSNIRKNVQRSLATDLQNLSMELRKKQSTYLKQLRQQKEEGQDGIDIEMNLNGNRSRMEDDDLEHMVFNEHQMAKLRKSEAFTAEREREIQQVVDSVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVATTVDEGLKQLQKAERTQKQGGMVMCASVLIIMCFVMLVLLILKTILF 329
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 29012129 29015734 - CcPI632755_02g016420.1 Cco02g1642 172399

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cco02g1642 329 FunFam Syntaxin-43 79 287 - -
Cco02g1642 329 SMART SynN_4 73 188 IPR006011 GO:0016020(InterPro)
Cco02g1642 329 Gene3D - 79 287 - -
Cco02g1642 329 SMART tSNARE_6 228 295 IPR000727 -
Cco02g1642 329 CDD SNARE_syntaxin16 237 294 - -
Cco02g1642 329 Pfam SNARE domain 269 321 IPR000727 -
Cco02g1642 329 SUPERFAMILY t-snare proteins 78 288 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cco02g1642 329 ProSitePatterns Syntaxin / epimorphin family signature. 239 278 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cco02g1642 329 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 233 295 IPR000727 -
Cco02g1642 329 PANTHER SYNTAXIN 91 313 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cco02g1642 K08489 - - csv:101207998 577.4
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cco02g1642 Cco-Chr2:29012129 Cco09g0532 Cco-Chr9:4656097 8.10E-104 dispersed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g133 . . . . . . . . . . Cma05g01087 Cma12g01045 Car05g00958 Car12g01004 . Cpe07g00878 Cpe11g00890 . . . . . . . Cla02g01497 Cam02g1577 Cec02g1601 Cco02g1642 Clacu02g1560 Cmu02g1513 Cre02g1836 Cone10ag0804 Cone3ag0826 . . . Csa02g00478 . Cme05g01576 . . Bda01g01638 . . . . Bma05g00265 Sed11g0396 Cmo05g01102 Cmo12g01056 . . . . . . Bhi06g01461 Tan08g0631 Cmetu05g1168 . Hepe08g2281 . . . . . . . . . Lsi11g00612 . Chy05g01060 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cco08g1446 . 8 365 SNARE and Associated Proteins AT3G24350 55.6 3.6e-89 325.5
Cco04g0763 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 1.4e-100 363.2
Cco04g1722 . 1 242 SNARE and Associated Proteins AT2G18260 55.7 3.8e-71 265.4
Cco10g1812 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.4e-115 411.8
Cco04g1261 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 1.3e-103 373.2
Cco03g0560 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.1e-92 337.0
Cco10g1337 . 30 284 SNARE and Associated Proteins AT3G11820 52.9 3.6e-69 258.8
Cco10g1812 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.7e-92 334.7
Cco04g1261 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Cco03g0560 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cco03g0560 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 3.0e-108 388.7
Cco10g1812 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 3.0e-84 308.9
Cco04g1261 . 1 297 SNARE and Associated Proteins AT4G03330 52.3 8.4e-79 290.8
Cco10g1337 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 1.2e-69 260.4
Cco03g0560 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.7e-128 453.4
Cco10g1812 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.5e-91 332.4
Cco04g1261 . 1 297 SNARE and Associated Proteins AT1G61290 56.9 9.2e-86 313.9
Cco03g0560 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cco10g1812 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.5e-93 339.7
Cco04g1261 . 1 291 SNARE and Associated Proteins AT1G11250 57.4 6.3e-87 317.8
Cco10g1337 . 1 303 SNARE and Associated Proteins AT3G03800 74.3 9.5e-115 410.2
Cco10g1337 . 1 202 SNARE and Associated Proteins AT5G08080 79.3 2.9e-81 298.5
Cco02g0923 . 1 225 SNARE and Associated Proteins AT5G08080 52.4 2.8e-47 185.7
Cco10g0147 . 1 256 SNARE and Associated Proteins AT5G16830 59.5 7.9e-76 280.8
Cco10g0147 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 3.9e-80 295.0
Cco10g0147 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 2.7e-73 272.3
Cco10g0147 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 4.4e-52 202.2
Cco07g0418 . 51 386 SNARE and Associated Proteins AT5G05760 65.9 3.1e-111 398.7
Cco08g1446 . 8 365 SNARE and Associated Proteins AT3G24350 55.6 3.6e-89 325.5
Cco02g1642 . 1 327 SNARE and Associated Proteins AT5G26980 76.1 3.0e-127 451.8
Cco09g0532 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 1.3e-101 366.7
Cco09g0532 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 1.1e-105 380.2
Cco02g1642 . 1 329 SNARE and Associated Proteins AT4G02195 64.0 7.2e-105 377.5
Cco02g1642 . 1 328 SNARE and Associated Proteins AT3G05710 75.7 2.5e-129 458.8
Cco09g0532 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 5.1e-98 354.8
Cco09g1113 . 1 233 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Cco10g0456 . 32 253 SNARE and Associated Proteins AT1G16240 68.5 2.0e-80 295.8
Cco09g1113 . 1 233 SNARE and Associated Proteins AT1G79590 71.2 1.1e-87 320.1
Cco10g0456 . 27 253 SNARE and Associated Proteins AT1G79590 67.0 9.2e-82 300.4
Cco06g0051 . 232 422 SNARE and Associated Proteins AT1G28490 71.7 8.3e-67 250.4
Cco10g2031 . 1 264 SNARE and Associated Proteins AT3G09740 78.9 3.8e-112 401.4
Cco02g2256 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 4.3e-95 344.7
Cco02g2256 . 1 265 SNARE and Associated Proteins AT3G45280 65.2 1.4e-90 329.7
Cco10g2031 . 1 264 SNARE and Associated Proteins AT3G45280 63.7 1.3e-86 316.6
Cco10g2031 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.1e-94 340.9
Cco02g2256 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 1.8e-85 312.8
Cco11g0653 . 65 309 SNARE and Associated Proteins AT1G51740 72.9 1.7e-90 329.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003497 3 1 2 2 1 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 4 4 2 46