Gene search
Sequence information

Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Cco03g1073 | ATGAAGCTCCAAGTCGCCGACGACGATCTCGACGCCCTTCTTCTTCCTCCTCCTAACTTCTCCATGGTTGAGGACGGCATTTTCCGATCCGGCTTCCCTCAGCCCCTCAATTTCCCCTTCCTCCGCACCCTCAATCTCCGCTCCATCATATATTTGTGTCCTGAACCCTACCCAGAGGAGAATTTGGAGTTTCTTAAAGCTAATAATATCAAGCTTTTTCAATTCAAAATTGAAGGCAAAAAGGAGCCTTTCGTTTCGATTCCGGAGGATGCTATTCTTGAGGCTCTAAAAATCCTTATTGATGTTAGGAATCACCCCATTTTGATCCACTGCAAGCGCGGAAAGCATCGAACAGGCTCGCTCGTTGGTTGCCTGAGGAAGTTTCAGAACTGGTGCTTGAGTTCGGTGTTTGAGGAGTACCAGCGATTTGCAGGCATGAAATCGAGGGTGACGGATCTACAATTCATCGAGAAATTCGACATTGGGTCTCTGAGGCAATGTGTTTACAGCATCATATATCAGTACCAAGGTTATAGCTCAAACAAGAGGAGGCTGTTGTATAGAGAAAACTTGCAAAAGCCTCAAACAACATCAGTTTAG | 600 | 45.83 | MKLQVADDDLDALLLPPPNFSMVEDGIFRSGFPQPLNFPFLRTLNLRSIIYLCPEPYPEENLEFLKANNIKLFQFKIEGKKEPFVSIPEDAILEALKILIDVRNHPILIHCKRGKHRTGSLVGCLRKFQNWCLSSVFEEYQRFAGMKSRVTDLQFIEKFDIGSLRQCVYSIIYQYQGYSSNKRRLLYRENLQKPQTTSV | 199 |
Gff information

Chromosome | Start | End | Strand | Old_gene | Gene | Num |
---|---|---|---|---|---|---|
3 | 18766671 | 18768379 | - | CcPI632755_03g010730.1 | Cco03g1073 | 174432 |
Annotation information

Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Cco03g1073 | 199 | PRINTS | Plant and fungal dual specificity phosphatase signature | 14 | 31 | IPR020428 | GO:0016791(InterPro) | |
Cco03g1073 | 199 | PRINTS | Plant and fungal dual specificity phosphatase signature | 51 | 64 | IPR020428 | GO:0016791(InterPro) | |
Cco03g1073 | 199 | PRINTS | Plant and fungal dual specificity phosphatase signature | 70 | 84 | IPR020428 | GO:0016791(InterPro) | |
Cco03g1073 | 199 | PRINTS | Plant and fungal dual specificity phosphatase signature | 87 | 101 | IPR020428 | GO:0016791(InterPro) | |
Cco03g1073 | 199 | CDD | PFA-DSP_Siw14 | 19 | 160 | - | - | |
Cco03g1073 | 199 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 109 | 119 | IPR016130 | GO:0016311(InterPro) | |
Cco03g1073 | 199 | Pfam | Tyrosine phosphatase family | 14 | 162 | IPR004861 | - | |
Cco03g1073 | 199 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 13 | 189 | - | GO:0005737(PANTHER)|GO:0016791(PANTHER) | |
Cco03g1073 | 199 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 19 | 170 | IPR020422 | GO:0006470(InterPro) | |
Cco03g1073 | 199 | Gene3D | Protein tyrosine phosphatase superfamily | 13 | 163 | IPR029021 | - | |
Cco03g1073 | 199 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 15 | 159 | IPR029021 | - | |
Cco03g1073 | 199 | FunFam | probable tyrosine-protein phosphatase At1g05000 | 13 | 163 | - | - |
Duplication type information

Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
---|---|---|---|---|---|---|
Cco03g1073 | Cco-Chr3:18766671 | Cco09g1122 | Cco-Chr9:10805440 | 6.50E-56 | dispersed | |
Cco03g1073 | Cco-Chr3:18766671 | Cco02g1936 | Cco-Chr2:32245867 | 2.50E-63 | transposed |
Pathway information

Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Cco03g1073 | K18045 | - | csv:101211082 | 360.918 |