Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cco04g1261 ATGAACGATCTGTTTTCCACCGATTCCTTCCGCCGACAGCAGCACCGCCATGACTCCGTCGAGATTCCCGACAACGCGCCGTCGTCAACGACTATCAATCTCAACAGTTTCTTCGACGACGTGGAGTCCGTGAAGGCGGAATTGACGGAGCTCGAGCGCCTGTATCGAAGCCTCCAGAATTCTCACGAACAGAGCAAAACTCTTCACAATTCGAAGGCGATTAAGGATCTTCGATCGCGAATGGAATCGGATGTGAATCTGGCTCTGAAGAAGGCTAGGTTTATCAAGCTCCGGTTGGAGGAACTGGACCGGTCCAATGCCGAGAACCGGAATCTTCCTGGTTGTGGCTATGGCTCCTCCGCCGACCGGTCAAGAACTTCCGTCGTCAATGGATTGAGGAAGAAGCTGTGTGATTCGATGGAGAGTTTCAATAGATTGAGAGAGGAGATTTCGTCGACGTATAAGGAGACGATTGAACGAAGGTATTTCACAATTACAGGGGAAAATCCTGATGAGAAGACGGTTGATTTGTTGATCTCTACAGGCGAAAGCGAAACATTCTTGCAAAAAGCAATACAAAAGCAAGGAAGAGGAAGAGTTTTGGAAACAATCCAAGAGATTCAAGAAAGGCATGACGCAGTGAAAGACATAGAGAGGAATTTGAGAGAGCTGCACCAAGTTTTCATGGACATGGCGGTGCTGGTTCAATCTCAGGGGCAGCAGTTGGACGATATCGAGAGCCAAGTAACTCGAGCCAACTCCGCCGTCAAGCGCGGCACCACGGAGCTACAAACTGCAAGATACTACCAGAAAAACACTCGCAAATGGATCTGCATAGGCGTCATCGTTCTCGCACTCGTTCTTTTCATCATTATCATCTCCGTCGTCCTTTCCAAGAAGTAG 903 48.84 MNDLFSTDSFRRQQHRHDSVEIPDNAPSSTTINLNSFFDDVESVKAELTELERLYRSLQNSHEQSKTLHNSKAIKDLRSRMESDVNLALKKARFIKLRLEELDRSNAENRNLPGCGYGSSADRSRTSVVNGLRKKLCDSMESFNRLREEISSTYKETIERRYFTITGENPDEKTVDLLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFMDMAVLVQSQGQQLDDIESQVTRANSAVKRGTTELQTARYYQKNTRKWICIGVIVLALVLFIIIISVVLSKK 300
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 27965463 27967031 + CcPI632755_04g012610.1 Cco04g1261 176486

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cco04g1261 300 ProSitePatterns Syntaxin / epimorphin family signature. 210 249 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cco04g1261 300 SMART tSNARE_6 199 266 IPR000727 -
Cco04g1261 300 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 204 266 IPR000727 -
Cco04g1261 300 FunFam Syntaxin 132 197 297 - -
Cco04g1261 300 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 31 161 - -
Cco04g1261 300 CDD SynN 34 191 IPR006011 GO:0016020(InterPro)
Cco04g1261 300 Gene3D - 199 298 - -
Cco04g1261 300 Pfam SNARE domain 241 292 IPR000727 -
Cco04g1261 300 SUPERFAMILY t-snare proteins 33 259 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cco04g1261 300 Coils Coil 34 68 - -
Cco04g1261 300 SMART SynN_4 29 155 IPR006011 GO:0016020(InterPro)
Cco04g1261 300 MobiDBLite consensus disorder prediction 1 27 - -
Cco04g1261 300 Gene3D - 32 164 - -
Cco04g1261 300 CDD SNARE_syntaxin1-like 203 265 - -
Cco04g1261 300 Pfam Syntaxin 36 239 IPR006011 GO:0016020(InterPro)
Cco04g1261 300 PANTHER SYNTAXIN 36 286 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cco04g1261 K08486 - - csv:101213199 496.123
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cco03g0560 Cco-Chr3:5724362 Cco04g1261 Cco-Chr4:27965463 2.00E-85 dispersed
Cco04g1261 Cco-Chr4:27965463 Cco04g1722 Cco-Chr4:32322285 2.90E-39 dispersed
Cco04g0763 Cco-Chr4:22778141 Cco04g1261 Cco-Chr4:27965463 5.70E-59 transposed
Cco10g1337 Cco-Chr10:26334438 Cco04g1261 Cco-Chr4:27965463 1.50E-70 transposed
Cco10g1812 Cco-Chr10:31699964 Cco04g1261 Cco-Chr4:27965463 2.00E-112 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cco08g1446 . 8 365 SNARE and Associated Proteins AT3G24350 55.6 3.6e-89 325.5
Cco04g0763 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 1.4e-100 363.2
Cco04g1722 . 1 242 SNARE and Associated Proteins AT2G18260 55.7 3.8e-71 265.4
Cco10g1812 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.4e-115 411.8
Cco04g1261 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 1.3e-103 373.2
Cco03g0560 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.1e-92 337.0
Cco10g1337 . 30 284 SNARE and Associated Proteins AT3G11820 52.9 3.6e-69 258.8
Cco10g1812 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.7e-92 334.7
Cco04g1261 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Cco03g0560 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cco03g0560 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 3.0e-108 388.7
Cco10g1812 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 3.0e-84 308.9
Cco04g1261 . 1 297 SNARE and Associated Proteins AT4G03330 52.3 8.4e-79 290.8
Cco10g1337 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 1.2e-69 260.4
Cco03g0560 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.7e-128 453.4
Cco10g1812 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.5e-91 332.4
Cco04g1261 . 1 297 SNARE and Associated Proteins AT1G61290 56.9 9.2e-86 313.9
Cco03g0560 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cco10g1812 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.5e-93 339.7
Cco04g1261 . 1 291 SNARE and Associated Proteins AT1G11250 57.4 6.3e-87 317.8
Cco10g1337 . 1 303 SNARE and Associated Proteins AT3G03800 74.3 9.5e-115 410.2
Cco10g1337 . 1 202 SNARE and Associated Proteins AT5G08080 79.3 2.9e-81 298.5
Cco02g0923 . 1 225 SNARE and Associated Proteins AT5G08080 52.4 2.8e-47 185.7
Cco10g0147 . 1 256 SNARE and Associated Proteins AT5G16830 59.5 7.9e-76 280.8
Cco10g0147 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 3.9e-80 295.0
Cco10g0147 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 2.7e-73 272.3
Cco10g0147 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 4.4e-52 202.2
Cco07g0418 . 51 386 SNARE and Associated Proteins AT5G05760 65.9 3.1e-111 398.7
Cco08g1446 . 8 365 SNARE and Associated Proteins AT3G24350 55.6 3.6e-89 325.5
Cco02g1642 . 1 327 SNARE and Associated Proteins AT5G26980 76.1 3.0e-127 451.8
Cco09g0532 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 1.3e-101 366.7
Cco09g0532 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 1.1e-105 380.2
Cco02g1642 . 1 329 SNARE and Associated Proteins AT4G02195 64.0 7.2e-105 377.5
Cco02g1642 . 1 328 SNARE and Associated Proteins AT3G05710 75.7 2.5e-129 458.8
Cco09g0532 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 5.1e-98 354.8
Cco09g1113 . 1 233 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Cco10g0456 . 32 253 SNARE and Associated Proteins AT1G16240 68.5 2.0e-80 295.8
Cco09g1113 . 1 233 SNARE and Associated Proteins AT1G79590 71.2 1.1e-87 320.1
Cco10g0456 . 27 253 SNARE and Associated Proteins AT1G79590 67.0 9.2e-82 300.4
Cco06g0051 . 232 422 SNARE and Associated Proteins AT1G28490 71.7 8.3e-67 250.4
Cco10g2031 . 1 264 SNARE and Associated Proteins AT3G09740 78.9 3.8e-112 401.4
Cco02g2256 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 4.3e-95 344.7
Cco02g2256 . 1 265 SNARE and Associated Proteins AT3G45280 65.2 1.4e-90 329.7
Cco10g2031 . 1 264 SNARE and Associated Proteins AT3G45280 63.7 1.3e-86 316.6
Cco10g2031 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.1e-94 340.9
Cco02g2256 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 1.8e-85 312.8
Cco11g0653 . 65 309 SNARE and Associated Proteins AT1G51740 72.9 1.7e-90 329.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62