Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cco10g0603 ATGGCCGCCACCGCCACCGCCACCTCCGCCACCCTCCTCCGGGCTACTCCCTTTCTTGGCCAGACCAGAGGCTCTTCCCAGAACTCCCTCAGAGATGTCGTCGCCATGGGAACTGGCAAATACACCATGGGAAATGATCTGTGGTATGGACCAGACAGAGTGAAGTACTTGGGGCCGTTTTCAGCTCAGACTCCATCCTACTTGAACGGTGAATTCCCCGGCGATTATGGATGGGACACTGCTGGCTTGTCCGCCGATCCCGAGGCCTTCGCCAAGAACAGAGCTCTCGAGGTGATCCACGGGAGGTGGGCCATGTTGGGAGCATTGGGTTGCATAACACCCGAAGTGCTAGAAAAATGGCTTAAAGTGGACTTCAAGGAGCCAGTGTGGTTCAAGGCAGGGGCCCAAATCTTCACAGAAGGTGGTCTAGACTACCTAGGCAACCCCAACCTGGTCCACGCCCAGAGCATCCTAGCCGTCTTGGGGTTCCAAGTGGTCCTAATGGGTCTTGTCGAAGGCTTCCGCATCAACGGCCTCGACGGTGTCGGCGAGGGCAACGACCTCTACCCGGGCGGTCAGTACTTTGACCCTCTCGGACTGGCCGATGACCCAGTCACCTTCGCGGAGCTGAAGGTCAAGGAGATCAAGAATGGCCGTCTTGCCATGTTTTCCATGTTTGGCTTCTTTGTTCAGGCCATTGTCACTGGAAAGGGCCCTCTTGAGAACCTTCTTGACCATCTTGATAACCCTGTGGCTAACAATGCCTGGGTTTATGCTACCAAGTTTGCCCCTGGCTCATAA 801 55.93 MAATATATSATLLRATPFLGQTRGSSQNSLRDVVAMGTGKYTMGNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWLKVDFKEPVWFKAGAQIFTEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFAPGS 266
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
10 8051347 8053066 + CcPI632755_10g006030.1 Cco10g0603 189561

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cco10g0603 266 FunFam Chlorophyll a-b binding protein, chloroplastic 55 259 - -
Cco10g0603 266 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 27 265 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Cco10g0603 266 SUPERFAMILY Chlorophyll a-b binding protein 47 263 - -
Cco10g0603 266 Gene3D Chlorophyll a/b binding protein domain 55 259 - -
Cco10g0603 266 Pfam Chlorophyll A-B binding protein 65 233 IPR022796 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cco10g0603 K08914 - - csv:101207278 521.161
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cco04g2218 Cco-Chr4:35799355 Cco10g0603 Cco-Chr10:8051347 1.50E-95 dispersed
Cco10g0603 Cco-Chr10:8051347 Cco10g1167 Cco-Chr10:24263188 4.30E-95 dispersed
Cco10g0603 Cco-Chr10:8051347 Cco02g1970 Cco-Chr2:32643188 1.30E-96 transposed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi19g298 . . Bda07g00273 . . . . . Cmo16g00863 . . . . . . . . . . . . . . . Cla10g00607 Cam10g0600 Cec10g0627 Cco10g0603 Clacu10g0629 . Cre10g0841 Cone6ag0112 Cone9ag0132 . . . Csa03g00595 . . . . . . Bpe11g00504 . . . . . . Cma04g00918 . . . Cpe14g00702 . Bhi11g00737 . . . . . . . . . . . . . Lsi05g00685 . Chy06g01728 .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cco03g0170 . 1 451 Chloroplast and Mitochondria Gene Families AT2G28800 61.4 9.2e-140 493.8
Cco08g1924 . 71 432 Chloroplast and Mitochondria Gene Families AT2G28800 56.0 1.4e-100 363.6
Cco08g0827 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 3.7e-120 427.9
Cco02g0294 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.1e-142 503.1
Cco02g1970 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.0 3.3e-120 428.3
Cco04g2218 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 1.2e-119 426.4
Cco03g0753 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 1.6e-119 426.0
Cco04g2219 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.8e-119 425.2
Cco10g1167 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.9 2.4e-118 422.2
Cco10g0603 . 5 266 Chloroplast and Mitochondria Gene Families AT3G27690 66.9 1.1e-96 350.1
Cco08g0264 . 73 276 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 6.5e-52 201.4
Cco11g1413 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 9.7e-129 456.4
Cco03g1546 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 1.6e-86 316.2
Cco06g1814 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 8.4e-64 240.7
Cco09g2259 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.7e-90 327.4
Cco10g2187 . 2 283 Chloroplast and Mitochondria Gene Families AT3G08940 84.5 2.5e-133 471.9
Cco04g0901 . 3 252 Chloroplast and Mitochondria Gene Families AT3G08940 80.5 4.0e-115 411.4
Cco11g1967 . 60 332 Chloroplast and Mitochondria Gene Families AT1G76570 79.1 7.7e-131 463.8
Cco03g1228 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.8 7.9e-137 483.4
Cco02g0294 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.9e-144 508.1
Cco04g2218 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.2e-120 428.7
Cco04g2219 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 5.0e-120 427.6
Cco03g0753 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 8.5e-120 426.8
Cco02g1970 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.6e-118 422.5
Cco10g1167 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 83.7 8.0e-118 420.2
Cco10g0603 . 7 266 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 3.5e-97 351.7
Cco08g0264 . 73 276 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.5e-52 201.8
Cco02g0294 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.6e-125 446.0
Cco04g2218 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.6e-101 366.3
Cco04g2219 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.6e-101 366.3
Cco03g0753 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 3.6e-101 365.2
Cco02g1970 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 2.4e-100 362.5
Cco10g1167 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 6.9e-100 360.9
Cco10g0603 . 7 238 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 4.9e-82 301.6
Cco08g0264 . 73 260 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.6e-43 173.7
Cco04g0901 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 7.6e-67 250.4
Cco10g2187 . 2 164 Chloroplast and Mitochondria Gene Families AT2G40100 67.9 1.1e-60 229.9
Cco03g0753 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.3e-136 482.6
Cco04g2218 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 2.9e-136 481.5
Cco04g2219 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 6.5e-136 480.3
Cco02g1970 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 87.7 5.5e-135 477.2
Cco10g1167 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.2 3.6e-126 448.0
Cco02g0294 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.4e-116 414.8
Cco10g0603 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 65.2 9.5e-95 343.6
Cco03g0753 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 5.0e-136 480.7
Cco04g2218 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.1e-135 479.6
Cco04g2219 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.5e-135 478.4
Cco02g1970 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 2.1e-134 475.3
Cco10g1167 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.2 4.7e-126 447.6
Cco02g0294 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.0e-116 415.6
Cco10g0603 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 65.2 1.6e-94 342.8
Cco08g0264 . 56 276 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 6.9e-53 204.5
Cco03g0753 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 5.0e-136 480.7
Cco04g2218 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.1e-135 479.6
Cco04g2219 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.5e-135 478.4
Cco02g1970 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 2.1e-134 475.3
Cco10g1167 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.2 4.7e-126 447.6
Cco02g0294 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.0e-116 415.6
Cco10g0603 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 65.2 1.6e-94 342.8
Cco08g0264 . 56 276 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 6.9e-53 204.5
Cco08g0264 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 84.7 5.1e-139 490.7
Cco02g1970 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 2.2e-57 219.5
Cco04g2219 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 3.7e-57 218.8
Cco04g2218 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 8.3e-57 217.6
Cco03g0753 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cco10g1167 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.1e-56 215.3
Cco02g0294 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.9e-54 209.1
Cco10g0603 . 48 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.6e-52 202.2
Cco03g0753 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 2.5e-135 478.4
Cco04g2218 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.2e-134 476.1
Cco04g2219 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 2.7e-134 474.9
Cco02g1970 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 87.7 3.6e-134 474.6
Cco10g1167 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.5 7.2e-127 450.3
Cco02g0294 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 6.7e-117 417.2
Cco10g0603 . 24 266 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 8.0e-94 340.5
Cco04g2218 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.7 3.5e-137 484.6
Cco04g2219 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 7.7e-137 483.4
Cco03g0753 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.7e-136 482.3
Cco02g1970 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 6.1e-134 473.8
Cco10g1167 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 84.8 1.0e-128 456.4
Cco02g0294 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.8e-114 409.1
Cco10g0603 . 36 266 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 8.1e-94 340.5
Cco10g2187 . 2 283 Chloroplast and Mitochondria Gene Families AT5G01530 87.3 1.6e-140 495.7
Cco04g0901 . 2 252 Chloroplast and Mitochondria Gene Families AT5G01530 81.7 6.0e-119 424.1
Cco10g0747 . 121 378 Chloroplast and Mitochondria Gene Families AT5G40810 93.4 4.6e-142 500.7
Cco10g0747 . 74 378 Chloroplast and Mitochondria Gene Families AT3G27240 85.6 2.3e-148 521.9
Cco02g2063 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.3 6.8e-143 503.8
Cco04g0860 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 64.2 1.2e-110 396.7
Cco02g2063 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 3.0e-143 505.0
Cco04g0860 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.5 2.2e-117 419.1
Cco09g0535 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 2.2e-135 478.8
Cco01g0612 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.5 1.4e-110 396.4
Cco01g0612 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 63.7 2.3e-123 439.1
Cco09g0535 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 2.5e-106 382.5
Cco03g0556 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.2 4.8e-261 897.1
Cco02g1852 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.1 3.9e-242 834.3
Cco02g0137 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.5 3.3e-225 778.1
Cco09g0073 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.3 3.3e-62 235.0
Cco06g1053 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 58.4 2.0e-51 199.1
Cco06g1053 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.0 2.7e-51 198.7
Cco09g0073 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.5e-41 166.4
Cco09g0073 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.4 4.4e-62 234.6
Cco06g1053 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.2 3.7e-53 204.9
Cco05g2578 . 647 869 Chloroplast and Mitochondria Gene Families AT1G26100 60.5 2.1e-69 259.2
Cco11g0544 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 2.1e-90 328.9
Cco09g1370 . 23 230 Chloroplast and Mitochondria Gene Families AT4G25570 68.5 8.8e-83 303.9
Cco01g0708 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 53.7 5.1e-65 244.6
Cco01g0817 . 9 356 Chloroplast and Mitochondria Gene Families AT5G14040 82.3 2.2e-169 592.0
Cco05g1465 . 10 357 Chloroplast and Mitochondria Gene Families AT5G14040 77.4 7.7e-159 557.0
Cco06g2028 . 39 340 Chloroplast and Mitochondria Gene Families AT5G14040 86.1 4.4e-154 541.2
Cco02g0352 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 51.9 3.1e-83 305.8
Cco01g0817 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 7.2e-146 513.8
Cco05g1465 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 70.9 1.4e-144 509.6
Cco06g2028 . 10 340 Chloroplast and Mitochondria Gene Families AT3G48850 68.7 9.2e-141 496.9
Cco02g0352 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 2.7e-84 309.3
Cco02g0352 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 3.5e-133 471.5
Cco05g1465 . 57 362 Chloroplast and Mitochondria Gene Families AT2G17270 51.9 1.2e-88 323.6
Cco01g0817 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 4.7e-85 311.6
Cco11g0501 . 71 374 Chloroplast and Mitochondria Gene Families AT5G15640 76.5 3.4e-131 464.9
Cco05g0806 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 51.0 1.9e-81 299.7
Cco05g2054 . 122 455 Chloroplast and Mitochondria Gene Families AT5G26200 66.5 3.3e-124 441.8
Cco09g0080 . 1 344 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 3.8e-104 375.2
Cco09g0080 . 1 348 Chloroplast and Mitochondria Gene Families AT1G72820 76.1 9.7e-148 520.0
Cco05g2054 . 111 456 Chloroplast and Mitochondria Gene Families AT1G72820 68.5 1.4e-130 463.0
Cco01g0248 . 82 290 Chloroplast and Mitochondria Gene Families AT5G52570 51.2 2.8e-50 195.7
Cco05g0997 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.7 5.2e-70 261.2
Cco01g0248 . 69 204 Chloroplast and Mitochondria Gene Families AT4G25700 74.3 1.9e-56 216.1
Cco02g0151 . 285 463 Chloroplast and Mitochondria Gene Families AT4G03320 51.7 2.4e-56 216.1
Cco10g0605 . 72 357 Chloroplast and Mitochondria Gene Families AT5G54290 78.7 1.5e-119 426.4
Cco06g1485 . 53 542 Chloroplast and Mitochondria Gene Families AT2G18710 85.6 9.4e-238 819.7
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0006810 2 1 0 2 1 1 0 1 1 1 1 1 2 1 1 2 0 2 2 1 1 2 2 1 1 1 1 1 1 1 35