Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cec02g0290 ATGGCCACCTCTGCTATCCAACAGTCCGCCTTCGCCGGCCAGGCTGCCTTGAAGCAATCCAATGAGCTCGTCCGAAGGGTTGGCGCTGTCGGTGGCGGCCGCTTCACCATGCGACGAACAGTCAAGAGTGCTCCACAGAGCATATGGTATGGACCAGATCGCCCAAAATACTTGGGACCATTCTCTGAACAAACACCATCTTACCTGACTGGAGAGTTCCCCGGTGACTATGGATGGGACACAGCCGGTCTATCAGCAGATCCCGAGACTTTTGCGAAGAACCGTGAGCTTGAGGTGATCCACTCCCGATGGGCGATGCTTGGTGCATTAGGTTGTGTCTTCCCTGAACTCCTTGCAAAGAATGGTGTCCAGTTCGGTGAATCAGTTTGGTTCAAGGCTGGTTCTCAGATCTTCTCTGAGGGTGGTCTAGATTACCTTGGCAACCCAAACCTCATCCATGCTCAGAGTATCCTTGCAATCTGGGCTGTCCAGGTTGTGCTCATGGGCTTCGTTGAAGGTTACCGGGTTGGTGGTGGTCCCCTTGGTGAAGGACTGGACCCAATTTACCCAGGAGGCGCCTTCGACCCACTCGGATTGGCAGATGACCCAGATGCATTTGCTGAGTTGAAGGTGAAGGAACTAAAGAATGGAAGGCTGGCAATGTTCTCCATGTTCGGATTCTTTGTCCAGGCTATCGTCACAGGAAAGGGTCCTATTGAGAATCTCTTTGACCATGTTGCAGATCCTGTTGCCAACAATGCATGGGCTTATGCCACCAACTTCGTCCCCGGAAAATGA 798 52.63 MATSAIQQSAFAGQAALKQSNELVRRVGAVGGGRFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKNGVQFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 265
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
2 2677248 2678434 - CePI673135_02g002900.1 Cec02g0290 195343

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cec02g0290 265 FunFam Chlorophyll a-b binding protein, chloroplastic 56 258 - -
Cec02g0290 265 Pfam Chlorophyll A-B binding protein 66 232 IPR022796 -
Cec02g0290 265 SUPERFAMILY Chlorophyll a-b binding protein 48 262 - -
Cec02g0290 265 Gene3D Chlorophyll a/b binding protein domain 56 258 - -
Cec02g0290 265 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 2 265 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec02g0290 K08913 - - csv:101212963 526.939
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec02g0290 Cec-Chr2:2677248 Cec02g1928 Cec-Chr2:37141034 2.90E-120 dispersed
Cec02g0290 Cec-Chr2:2677248 Cec04g2142 Cec-Chr4:39269986 9.90E-121 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cec03g0162 . 16 451 Chloroplast and Mitochondria Gene Families AT2G28800 62.6 1.3e-138 490.0
Cec08g1809 . 71 432 Chloroplast and Mitochondria Gene Families AT2G28800 55.0 1.9e-100 363.2
Cec08g0719 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 3.7e-120 427.9
Cec02g0290 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.0e-142 503.1
Cec02g1928 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 6.5e-121 430.6
Cec04g2142 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 3.2e-120 428.3
Cec04g2143 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.7e-119 425.2
Cec03g0717 . 43 234 Chloroplast and Mitochondria Gene Families AT3G27690 89.6 2.3e-102 369.0
Cec10g0627 . 5 266 Chloroplast and Mitochondria Gene Families AT3G27690 66.9 1.1e-96 350.1
Cec08g0043 . 109 312 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 6.5e-52 201.4
Cec11g1417 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 9.6e-129 456.4
Cec03g1553 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 1.2e-86 316.6
Cec06g1811 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 1.4e-63 240.0
Cec09g2164 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.6e-90 327.4
Cec04g0849 . 3 285 Chloroplast and Mitochondria Gene Families AT3G08940 82.0 2.9e-134 474.9
Cec10g2202 . 41 306 Chloroplast and Mitochondria Gene Families AT3G08940 83.9 2.9e-126 448.4
Cec11g1955 . 59 326 Chloroplast and Mitochondria Gene Families AT1G76570 79.5 2.9e-130 461.8
Cec03g1252 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.4 1.3e-136 482.6
Cec02g0290 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.9e-144 508.1
Cec04g2142 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 9.9e-121 429.9
Cec04g2143 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 4.9e-120 427.6
Cec02g1928 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.4e-120 427.2
Cec03g0717 . 43 234 Chloroplast and Mitochondria Gene Families AT2G05070 89.6 4.6e-102 367.9
Cec10g0627 . 7 266 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 3.4e-97 351.7
Cec08g0043 . 109 312 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.4e-52 201.8
Cec02g0290 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.6e-125 446.0
Cec04g2142 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.5e-102 367.9
Cec04g2143 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.6e-101 366.3
Cec02g1928 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 4.7e-101 364.8
Cec03g0717 . 43 206 Chloroplast and Mitochondria Gene Families AT2G05100 89.0 6.8e-84 307.8
Cec10g0627 . 7 238 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 4.9e-82 301.6
Cec08g0043 . 109 296 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.5e-43 173.7
Cec04g0849 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.2 2.9e-66 248.4
Cec10g2202 . 41 203 Chloroplast and Mitochondria Gene Families AT2G40100 67.9 1.1e-60 229.9
Cec02g1928 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.7e-136 482.3
Cec04g2142 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 3.8e-136 481.1
Cec04g2143 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 6.5e-136 480.3
Cec02g0290 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.3e-116 414.8
Cec03g0717 . 1 234 Chloroplast and Mitochondria Gene Families AT1G29930 76.8 8.5e-112 400.2
Cec10g0627 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 65.2 9.4e-95 343.6
Cec02g1928 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 6.5e-136 480.3
Cec04g2142 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.4e-135 479.2
Cec04g2143 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.5e-135 478.4
Cec02g0290 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.0e-116 415.6
Cec03g0717 . 1 234 Chloroplast and Mitochondria Gene Families AT1G29920 76.4 3.2e-111 398.3
Cec10g0627 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 65.2 1.6e-94 342.8
Cec08g0043 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 6.8e-53 204.5
Cec02g1928 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 6.5e-136 480.3
Cec04g2142 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.4e-135 479.2
Cec04g2143 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.5e-135 478.4
Cec02g0290 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.0e-116 415.6
Cec03g0717 . 1 234 Chloroplast and Mitochondria Gene Families AT1G29910 76.4 3.2e-111 398.3
Cec10g0627 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 65.2 1.6e-94 342.8
Cec08g0043 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 6.8e-53 204.5
Cec08g0043 . 47 327 Chloroplast and Mitochondria Gene Families AT4G10340 84.7 5.0e-139 490.7
Cec04g2143 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 3.7e-57 218.8
Cec04g2142 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.3e-57 218.0
Cec02g1928 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cec02g0290 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.9e-54 209.1
Cec10g0627 . 48 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.6e-52 202.2
Cec03g0717 . 27 222 Chloroplast and Mitochondria Gene Families AT4G10340 51.8 1.1e-50 197.2
Cec02g1928 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.1e-135 479.6
Cec04g2142 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.6e-134 475.7
Cec04g2143 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 2.7e-134 474.9
Cec02g0290 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 6.7e-117 417.2
Cec03g0717 . 1 234 Chloroplast and Mitochondria Gene Families AT2G34420 74.9 1.8e-109 392.5
Cec10g0627 . 24 266 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 7.9e-94 340.5
Cec04g2143 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 7.6e-137 483.4
Cec04g2142 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 2.9e-136 481.5
Cec02g1928 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 1.9e-135 478.8
Cec02g0290 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.8e-114 409.1
Cec03g0717 . 1 234 Chloroplast and Mitochondria Gene Families AT2G34430 76.3 2.9e-112 401.7
Cec10g0627 . 36 266 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 8.0e-94 340.5
Cec04g0849 . 2 285 Chloroplast and Mitochondria Gene Families AT5G01530 83.2 4.4e-138 487.6
Cec10g2202 . 38 306 Chloroplast and Mitochondria Gene Families AT5G01530 86.7 6.6e-134 473.8
Cec10g0767 . 120 379 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 2.4e-143 505.0
Cec10g0767 . 73 379 Chloroplast and Mitochondria Gene Families AT3G27240 85.7 1.2e-149 526.2
Cec02g2028 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 74.7 1.3e-141 499.6
Cec04g0807 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 63.9 1.5e-110 396.4
Cec02g2028 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 75.8 5.6e-142 500.7
Cec04g0807 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.2 2.8e-117 418.7
Cec09g0539 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 2.2e-135 478.8
Cec01g0586 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.5 1.4e-110 396.4
Cec01g0586 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 63.7 2.2e-123 439.1
Cec09g0539 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 2.5e-106 382.5
Cec03g0537 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.2 1.1e-260 896.0
Cec02g1805 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.0 5.0e-242 833.9
Cec02g0140 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.5 7.2e-225 776.9
Cec09g0077 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.3 3.2e-62 235.0
Cec06g1009 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.0 1.5e-51 199.5
Cec06g1009 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.5 2.0e-51 199.1
Cec09g0077 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.5e-41 166.4
Cec09g0077 . 15 187 Chloroplast and Mitochondria Gene Families AT1G72750 68.0 2.0e-62 235.7
Cec06g1009 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 2.8e-53 205.3
Cec05g2535 . 663 837 Chloroplast and Mitochondria Gene Families AT1G26100 69.1 1.3e-66 250.0
Cec11g0556 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 7.9e-90 327.0
Cec09g1347 . 23 230 Chloroplast and Mitochondria Gene Families AT4G25570 69.0 1.7e-83 306.2
Cec01g0680 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 52.8 1.5e-64 243.0
Cec01g0787 . 9 363 Chloroplast and Mitochondria Gene Families AT5G14040 81.5 7.3e-170 593.6
Cec05g1439 . 10 364 Chloroplast and Mitochondria Gene Families AT5G14040 76.0 1.3e-158 556.2
Cec06g2021 . 39 340 Chloroplast and Mitochondria Gene Families AT5G14040 86.4 1.1e-154 543.1
Cec02g0347 . 11 297 Chloroplast and Mitochondria Gene Families AT5G14040 52.1 8.9e-83 304.3
Cec01g0787 . 8 363 Chloroplast and Mitochondria Gene Families AT3G48850 71.5 2.5e-146 515.4
Cec05g1439 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 1.0e-144 510.0
Cec06g2021 . 10 340 Chloroplast and Mitochondria Gene Families AT3G48850 68.7 5.3e-141 497.7
Cec02g0347 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 6.0e-84 308.1
Cec02g0347 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 1.3e-132 469.5
Cec05g1439 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 52.5 3.4e-88 322.0
Cec01g0787 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 4.6e-85 311.6
Cec11g0505 . 71 374 Chloroplast and Mitochondria Gene Families AT5G15640 76.5 3.3e-131 464.9
Cec05g0805 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.7 1.6e-80 296.6
Cec05g1996 . 122 455 Chloroplast and Mitochondria Gene Families AT5G26200 66.5 5.6e-124 441.0
Cec09g0081 . 1 344 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 6.4e-104 374.4
Cec09g0081 . 1 348 Chloroplast and Mitochondria Gene Families AT1G72820 76.1 9.6e-148 520.0
Cec05g1996 . 111 456 Chloroplast and Mitochondria Gene Families AT1G72820 69.1 1.6e-131 466.1
Cec01g0233 . 83 285 Chloroplast and Mitochondria Gene Families AT5G52570 51.7 3.1e-49 192.2
Cec05g1000 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.2 1.2e-69 260.0
Cec01g0233 . 69 204 Chloroplast and Mitochondria Gene Families AT4G25700 72.1 1.4e-54 209.9
Cec02g0156 . 148 326 Chloroplast and Mitochondria Gene Families AT4G03320 52.2 8.3e-57 217.6
Cec10g0629 . 72 364 Chloroplast and Mitochondria Gene Families AT5G54290 77.6 6.2e-118 421.0
Cec06g1482 . 53 543 Chloroplast and Mitochondria Gene Families AT2G18710 85.2 2.1e-237 818.5
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201