Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cec02g1601 ATGATTATTCAGGTGGGGATAGATCCTTCCACTCCTCCCGAGTTCGAAGAGTTTTGGAATTCTTTCCAACGAGAATTCGAGCTCTTCCTCCCTCTCCCCATGGCGTCGAGGAACCGGACTTTGCTTTTTAGGAAATACAGGGACGCGTTGAGGAGTGTGAGGGTTCCTACCAGCTCGTCGCCTGTTTCTGCATCACCATCGACTAGCTCTGCCGCTGGTGGCCCGGTGATTGAATTGGTTAGCTCATCGTTGTTGAATCCCAATCGGTCGTACGCTCCATTAAGTACTGAGGATCCGGGTAATTCAAGTAAGGGTGCTCTTACCGTTGGTCTACCTCCGGCTTGGGTGGATGTATCTGAAGAAATAGCTGCAAATGTGCAGCGTGCACGAGTGAAGATGGTGGAGTTAGCTAAGGCTCATGCGAAGGCTTTAATGCCTTCATTTGGAGATGGTAAAGAGGATCAACGTTTAATTGAATCTCTCACACAAGACATAACTAATTTAATCAAGAAATCAGAGAAAGGACTCAAGAGACTCTCTGTAGCCGGACCTTCAGAAGATTCCAATATCAGAAAAAATGTTCAGCGATCTCTTGCCACTGATCTTCAGAACCTTTCCATGGAGCTTCGCAAGAAACAATCAACATATTTAAAGCGGCTACGGCAGCAAAAAGAGGAAGGTCAAGATGGGATTGACATAGAGATGAATCTAAATGGAAATAGATCGAGAATGGAGGACGATGATTTAGAACATATGGTATTTAATGAGCATCAGATGGCTAAGCTGCGAAAGAGTGAAGCATTCACCGCCGAAAGAGAGAGAGAGATCCAACAAGTTGTAGAATCCGTGAATGAGCTTGCTCAGATCATGAAGGATCTATCTGTACTTGTCATAGACCAGGGTACCATCATCGATAGAATAGATTACAATATTCAAAATGTTGCAACGACCGTCGATGAGGGCCTTAAGCAACTGCAAAAGGCAGAGAGAACACAGAAACAAGGAGGGATGGTGATGTGCGCATCCGTGCTCATTATCATGTGCTTTGTCATGTTGGTTCTTCTGATCCTCAAAACCGCCAATCAGAGATTTCAGCGTTTTTCGGTTAGGGAAGGGGGTGGGATTTAG 1128 45.3 MIIQVGIDPSTPPEFEEFWNSFQREFELFLPLPMASRNRTLLFRKYRDALRSVRVPTSSSPVSASPSTSSAAGGPVIELVSSSLLNPNRSYAPLSTEDPGNSSKGALTVGLPPAWVDVSEEIAANVQRARVKMVELAKAHAKALMPSFGDGKEDQRLIESLTQDITNLIKKSEKGLKRLSVAGPSEDSNIRKNVQRSLATDLQNLSMELRKKQSTYLKRLRQQKEEGQDGIDIEMNLNGNRSRMEDDDLEHMVFNEHQMAKLRKSEAFTAEREREIQQVVESVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVATTVDEGLKQLQKAERTQKQGGMVMCASVLIIMCFVMLVLLILKTANQRFQRFSVREGGGI 375
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 33562431 33567113 - CePI673135_02g016010.1 Cec02g1601 196654

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cec02g1601 375 SMART tSNARE_6 261 328 IPR000727 -
Cec02g1601 375 Pfam SNARE domain 302 354 IPR000727 -
Cec02g1601 375 SUPERFAMILY t-snare proteins 111 321 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cec02g1601 375 FunFam Syntaxin-43 112 320 - -
Cec02g1601 375 ProSitePatterns Syntaxin / epimorphin family signature. 272 311 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cec02g1601 375 PANTHER SYNTAXIN 124 346 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cec02g1601 375 SMART SynN_4 106 221 IPR006011 GO:0016020(InterPro)
Cec02g1601 375 CDD SNARE_syntaxin16 270 327 - -
Cec02g1601 375 Gene3D - 112 320 - -
Cec02g1601 375 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 266 328 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec02g1601 K08489 - - csv:101207998 574.704
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec02g1601 Cec-Chr2:33562431 Cec09g0536 Cec-Chr9:4613302 1.70E-102 dispersed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g133 . . . . . . . . . . Cma05g01087 Cma12g01045 Car05g00958 Car12g01004 . Cpe07g00878 Cpe11g00890 . . . . . . . Cla02g01497 Cam02g1577 Cec02g1601 Cco02g1642 Clacu02g1560 Cmu02g1513 Cre02g1836 Cone10ag0804 Cone3ag0826 . . . Csa02g00478 . Cme05g01576 . . Bda01g01638 . . . . Bma05g00265 Sed11g0396 Cmo05g01102 Cmo12g01056 . . . . . . Bhi06g01461 Tan08g0631 Cmetu05g1168 . Hepe08g2281 . . . . . . . . . Lsi11g00612 . Chy05g01060 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec04g0715 . 1 309 SNARE and Associated Proteins AT1G08560 69.3 6.0e-101 364.4
Cec04g1660 . 23 325 SNARE and Associated Proteins AT2G18260 54.2 7.7e-85 310.8
Cec10g1837 . 19 279 SNARE and Associated Proteins AT3G11820 80.5 1.3e-114 409.8
Cec04g1193 . 22 282 SNARE and Associated Proteins AT3G11820 71.6 5.0e-103 371.3
Cec03g0540 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Cec10g1365 . 442 696 SNARE and Associated Proteins AT3G11820 52.5 8.0e-69 257.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 4.7e-91 331.6
Cec04g1193 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 1.7e-85 313.2
Cec03g0540 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cec10g1365 . 444 696 SNARE and Associated Proteins AT3G52400 51.0 6.0e-62 235.0
Cec03g0540 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 4.2e-83 305.1
Cec04g1193 . 1 297 SNARE and Associated Proteins AT4G03330 52.3 6.3e-79 291.2
Cec10g1365 . 433 696 SNARE and Associated Proteins AT4G03330 53.8 3.9e-68 255.4
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G61290 62.4 6.1e-90 327.8
Cec04g1193 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.2e-85 313.5
Cec10g1365 . 448 696 SNARE and Associated Proteins AT1G61290 50.6 8.3e-63 237.7
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G11250 62.0 4.9e-92 334.7
Cec04g1193 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 6.2e-87 317.8
Cec10g1365 . 432 696 SNARE and Associated Proteins AT1G11250 50.6 2.1e-66 249.6
Cec10g1365 . 417 715 SNARE and Associated Proteins AT3G03800 74.2 6.7e-113 404.1
Cec02g0887 . 38 271 SNARE and Associated Proteins AT3G03800 59.8 6.4e-71 264.6
Cec10g1365 . 417 614 SNARE and Associated Proteins AT5G08080 78.4 1.0e-78 290.0
Cec02g0887 . 24 224 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 6.6e-75 277.7
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 3.0e-80 295.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 5.8e-73 271.2
Cec10g0147 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 3.3e-52 202.6
Cec07g0462 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 1.8e-111 399.4
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec02g1601 . 34 359 SNARE and Associated Proteins AT5G26980 76.7 7.8e-128 453.8
Cec09g0536 . 1 317 SNARE and Associated Proteins AT5G26980 66.2 6.9e-100 360.9
Cec02g1601 . 34 359 SNARE and Associated Proteins AT4G02195 64.0 3.5e-104 375.2
Cec09g0536 . 1 317 SNARE and Associated Proteins AT4G02195 66.1 1.9e-102 369.4
Cec02g1601 . 34 359 SNARE and Associated Proteins AT3G05710 76.1 1.1e-129 459.9
Cec09g0536 . 1 317 SNARE and Associated Proteins AT3G05710 63.7 3.6e-96 348.6
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G16240 72.7 5.7e-80 294.3
Cec10g0467 . 32 247 SNARE and Associated Proteins AT1G16240 68.5 1.2e-77 286.6
Cec10g0467 . 27 247 SNARE and Associated Proteins AT1G79590 67.0 5.5e-79 291.2
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G79590 71.3 5.1e-77 284.6
Cec06g0054 . 136 326 SNARE and Associated Proteins AT1G28490 71.7 8.1e-67 250.4
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G09740 79.3 1.0e-112 403.3
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.9e-95 345.9
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G45280 64.0 3.2e-87 318.5
Cec10g2046 . 104 364 SNARE and Associated Proteins AT3G61450 68.2 5.4e-95 344.4
Cec02g2216 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.0e-85 312.0
Cec11g0667 . 65 307 SNARE and Associated Proteins AT1G51740 73.1 1.4e-89 326.2
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003497 3 1 2 2 1 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 4 4 2 46