Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cec02g2216 ATGACCGTAATCGACATCATCTTCCGAGTCGATTCCATTTGCAAGAAATATGAGAAGTATGATGTCGAGAAACAGCGTGAACTCAATGCTTATGGTGACGATGCCTTTGCTCGCCTCTTCGCCGCCGTCGAACTCGAAATCGACGCCGCTCTCCAGAAATCTGAGGCTGCCTCAACTGAGAAGAATAGAGCTGCTGCAGTTGCAATGAACGCTGAGGTTCGACGGAAGAAGGCTCGATTGATGGATGAAGTCCCTAAGCTTCGTAAATTGGCTCATAAGAAGGTTAAAGGGGTTCCGAAAGAAGAGCTGGAGGTCAGAGATGATCTTGTTCTTGCGCTTGAAGAGAAGATTAAAGCCATACCAGATGGGAGTACCTCAGGAGCCAAACAATCTGGAGGATGGGGGTCCTCCTCCTCATCTAACAATATCAAGTTTGATTCATCAGATGGAAACTTTGAGAGCGAGTATTTCCAGCAAAGTGAAGAATCAAGCCAATTTCGAAATGAGTATGAAATGCGGAAGATGAAACAGGACCAAGGTCTCGATGTCATATCTGAAGGTTTGGATATGCTGAAAAATCTAGCCCATGATATGAATGAGGAATTGGACAGGCAAGTTCCATTAATCGACGAGATTGACGCAAAGGTAGACAAGGTGACTGATGAGATTAAAAATACCAATGTTAGGCTCAAGGAAACGCTCTTTGAGGTGAGATCCAGCCAAAACTTCTGCATTGATATTATTCTTCTCTGTATAATTCTTGGAATTGCTTCTTACTTGTACAATATATTGAGCTGA 798 43.48 MTVIDIIFRVDSICKKYEKYDVEKQRELNAYGDDAFARLFAAVELEIDAALQKSEAASTEKNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELEVRDDLVLALEEKIKAIPDGSTSGAKQSGGWGSSSSSNNIKFDSSDGNFESEYFQQSEESSQFRNEYEMRKMKQDQGLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDAKVDKVTDEIKNTNVRLKETLFEVRSSQNFCIDIILLCIILGIASYLYNILS 265
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 39590193 39592553 + CePI673135_02g022160.1 Cec02g2216 197269

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cec02g2216 265 Coils Coil 209 229 - -
Cec02g2216 265 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 171 233 IPR000727 -
Cec02g2216 265 MobiDBLite consensus disorder prediction 124 145 - -
Cec02g2216 265 CDD SNARE_Qc 176 232 - -
Cec02g2216 265 ProSitePatterns Syntaxin / epimorphin family signature. 177 216 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cec02g2216 265 Pfam SNARE domain 208 257 IPR000727 -
Cec02g2216 265 PANTHER SYNTAXIN 45 251 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cec02g2216 265 FunFam Putative syntaxin-71-like 171 232 - -
Cec02g2216 265 Gene3D - 171 232 - -
Cec02g2216 265 MobiDBLite consensus disorder prediction 122 145 - -
Cec02g2216 265 SMART tSNARE_6 166 233 IPR000727 -
Cec02g2216 265 SUPERFAMILY SNARE fusion complex 167 231 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec02g2216 K08506 - - csv:101211289 446.817
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec10g2046 Cec-Chr10:35202391 Cec02g2216 Cec-Chr2:39590193 7.80E-100 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec04g0715 . 1 309 SNARE and Associated Proteins AT1G08560 69.3 6.0e-101 364.4
Cec04g1660 . 23 325 SNARE and Associated Proteins AT2G18260 54.2 7.7e-85 310.8
Cec10g1837 . 19 279 SNARE and Associated Proteins AT3G11820 80.5 1.3e-114 409.8
Cec04g1193 . 22 282 SNARE and Associated Proteins AT3G11820 71.6 5.0e-103 371.3
Cec03g0540 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Cec10g1365 . 442 696 SNARE and Associated Proteins AT3G11820 52.5 8.0e-69 257.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 4.7e-91 331.6
Cec04g1193 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 1.7e-85 313.2
Cec03g0540 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cec10g1365 . 444 696 SNARE and Associated Proteins AT3G52400 51.0 6.0e-62 235.0
Cec03g0540 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 4.2e-83 305.1
Cec04g1193 . 1 297 SNARE and Associated Proteins AT4G03330 52.3 6.3e-79 291.2
Cec10g1365 . 433 696 SNARE and Associated Proteins AT4G03330 53.8 3.9e-68 255.4
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G61290 62.4 6.1e-90 327.8
Cec04g1193 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.2e-85 313.5
Cec10g1365 . 448 696 SNARE and Associated Proteins AT1G61290 50.6 8.3e-63 237.7
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G11250 62.0 4.9e-92 334.7
Cec04g1193 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 6.2e-87 317.8
Cec10g1365 . 432 696 SNARE and Associated Proteins AT1G11250 50.6 2.1e-66 249.6
Cec10g1365 . 417 715 SNARE and Associated Proteins AT3G03800 74.2 6.7e-113 404.1
Cec02g0887 . 38 271 SNARE and Associated Proteins AT3G03800 59.8 6.4e-71 264.6
Cec10g1365 . 417 614 SNARE and Associated Proteins AT5G08080 78.4 1.0e-78 290.0
Cec02g0887 . 24 224 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 6.6e-75 277.7
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 3.0e-80 295.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 5.8e-73 271.2
Cec10g0147 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 3.3e-52 202.6
Cec07g0462 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 1.8e-111 399.4
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec02g1601 . 34 359 SNARE and Associated Proteins AT5G26980 76.7 7.8e-128 453.8
Cec09g0536 . 1 317 SNARE and Associated Proteins AT5G26980 66.2 6.9e-100 360.9
Cec02g1601 . 34 359 SNARE and Associated Proteins AT4G02195 64.0 3.5e-104 375.2
Cec09g0536 . 1 317 SNARE and Associated Proteins AT4G02195 66.1 1.9e-102 369.4
Cec02g1601 . 34 359 SNARE and Associated Proteins AT3G05710 76.1 1.1e-129 459.9
Cec09g0536 . 1 317 SNARE and Associated Proteins AT3G05710 63.7 3.6e-96 348.6
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G16240 72.7 5.7e-80 294.3
Cec10g0467 . 32 247 SNARE and Associated Proteins AT1G16240 68.5 1.2e-77 286.6
Cec10g0467 . 27 247 SNARE and Associated Proteins AT1G79590 67.0 5.5e-79 291.2
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G79590 71.3 5.1e-77 284.6
Cec06g0054 . 136 326 SNARE and Associated Proteins AT1G28490 71.7 8.1e-67 250.4
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G09740 79.3 1.0e-112 403.3
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.9e-95 345.9
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G45280 64.0 3.2e-87 318.5
Cec10g2046 . 104 364 SNARE and Associated Proteins AT3G61450 68.2 5.4e-95 344.4
Cec02g2216 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.0e-85 312.0
Cec11g0667 . 65 307 SNARE and Associated Proteins AT1G51740 73.1 1.4e-89 326.2
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63