Gene search
Sequence information

Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Cec03g1081 | ATGAAGCTCCAAGTCGCCGACGACCATCTCGACGCCCTTCTTCTTCCTCCTCCTAACTTCTCCATGGTTGAGGACGGCATTTTCCGATCCGGCTTCCCTCAGCCCCTCAATTTCCCCTTCCTCCGCACCCTCAATCTCCGCTCCATCATATATTTGTGTCCTGAACCCTACCCAGAGGAGAATTTGGAGTTTCTTAAAGCTAATAATATCAAGCTTTTTCAATTCAAAATTGAAGGCAAAAAGGAGCCTTTCGTTTCGATTCCAGAGGATGCTATTCTTGAGGCTCTAAAAATCCTGATTGATGTTAGGAATCACCCCATTTTGATCCACTGCAAGCGTGGAAAGCATCGAACAGGCTCGCTCGTTGGTTGCCTGAGGAAGTTTCAGAACTGGTGCTTGAGTTCGGTGTTCGAGGAGTACCAGCGATTTGCAGGCATGAAATCGAGGGTGACGGATCTACAATTCATCGAGAAATTCGACATTGGGTCTCTGAGGCAATGTGTTTACAGCATCATATATCAGTATCAAGGTTATAGCTCAAACAAGAGGAGGCTGTTGTATAGAGAAGAAAACTTGCAAAAGCCTCAAACAACATCAGTTTAG | 603 | 45.61 | MKLQVADDHLDALLLPPPNFSMVEDGIFRSGFPQPLNFPFLRTLNLRSIIYLCPEPYPEENLEFLKANNIKLFQFKIEGKKEPFVSIPEDAILEALKILIDVRNHPILIHCKRGKHRTGSLVGCLRKFQNWCLSSVFEEYQRFAGMKSRVTDLQFIEKFDIGSLRQCVYSIIYQYQGYSSNKRRLLYREENLQKPQTTSV | 200 |
Gff information

Chromosome | Start | End | Strand | Old_gene | Gene | Num |
---|---|---|---|---|---|---|
3 | 22447885 | 22449569 | - | CePI673135_03g010810.1 | Cec03g1081 | 198705 |
Annotation information

Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Cec03g1081 | 200 | Pfam | Tyrosine phosphatase family | 14 | 162 | IPR004861 | - | |
Cec03g1081 | 200 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 15 | 159 | IPR029021 | - | |
Cec03g1081 | 200 | FunFam | probable tyrosine-protein phosphatase At1g05000 | 13 | 163 | - | - | |
Cec03g1081 | 200 | Gene3D | Protein tyrosine phosphatase superfamily | 13 | 163 | IPR029021 | - | |
Cec03g1081 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 87 | 101 | IPR020428 | GO:0016791(InterPro) | |
Cec03g1081 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 14 | 31 | IPR020428 | GO:0016791(InterPro) | |
Cec03g1081 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 70 | 84 | IPR020428 | GO:0016791(InterPro) | |
Cec03g1081 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 51 | 64 | IPR020428 | GO:0016791(InterPro) | |
Cec03g1081 | 200 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 13 | 191 | - | GO:0005737(PANTHER)|GO:0016791(PANTHER) | |
Cec03g1081 | 200 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 19 | 170 | IPR020422 | GO:0006470(InterPro) | |
Cec03g1081 | 200 | CDD | PFA-DSP_Siw14 | 13 | 160 | - | - | |
Cec03g1081 | 200 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 109 | 119 | IPR016130 | GO:0016311(InterPro) |
Duplication type information

Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
---|---|---|---|---|---|---|
Cec03g1081 | Cec-Chr3:22447885 | Cec09g1099 | Cec-Chr9:10827108 | 3.80E-56 | dispersed | |
Cec03g1081 | Cec-Chr3:22447885 | Cec02g1896 | Cec-Chr2:36733456 | 7.10E-63 | transposed |
Pathway information

Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Cec03g1081 | K18045 | - | csv:101211082 | 367.466 |