Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cec03g1081 ATGAAGCTCCAAGTCGCCGACGACCATCTCGACGCCCTTCTTCTTCCTCCTCCTAACTTCTCCATGGTTGAGGACGGCATTTTCCGATCCGGCTTCCCTCAGCCCCTCAATTTCCCCTTCCTCCGCACCCTCAATCTCCGCTCCATCATATATTTGTGTCCTGAACCCTACCCAGAGGAGAATTTGGAGTTTCTTAAAGCTAATAATATCAAGCTTTTTCAATTCAAAATTGAAGGCAAAAAGGAGCCTTTCGTTTCGATTCCAGAGGATGCTATTCTTGAGGCTCTAAAAATCCTGATTGATGTTAGGAATCACCCCATTTTGATCCACTGCAAGCGTGGAAAGCATCGAACAGGCTCGCTCGTTGGTTGCCTGAGGAAGTTTCAGAACTGGTGCTTGAGTTCGGTGTTCGAGGAGTACCAGCGATTTGCAGGCATGAAATCGAGGGTGACGGATCTACAATTCATCGAGAAATTCGACATTGGGTCTCTGAGGCAATGTGTTTACAGCATCATATATCAGTATCAAGGTTATAGCTCAAACAAGAGGAGGCTGTTGTATAGAGAAGAAAACTTGCAAAAGCCTCAAACAACATCAGTTTAG 603 45.61 MKLQVADDHLDALLLPPPNFSMVEDGIFRSGFPQPLNFPFLRTLNLRSIIYLCPEPYPEENLEFLKANNIKLFQFKIEGKKEPFVSIPEDAILEALKILIDVRNHPILIHCKRGKHRTGSLVGCLRKFQNWCLSSVFEEYQRFAGMKSRVTDLQFIEKFDIGSLRQCVYSIIYQYQGYSSNKRRLLYREENLQKPQTTSV 200
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
3 22447885 22449569 - CePI673135_03g010810.1 Cec03g1081 198705

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cec03g1081 200 Pfam Tyrosine phosphatase family 14 162 IPR004861 -
Cec03g1081 200 SUPERFAMILY (Phosphotyrosine protein) phosphatases II 15 159 IPR029021 -
Cec03g1081 200 FunFam probable tyrosine-protein phosphatase At1g05000 13 163 - -
Cec03g1081 200 Gene3D Protein tyrosine phosphatase superfamily 13 163 IPR029021 -
Cec03g1081 200 PRINTS Plant and fungal dual specificity phosphatase signature 87 101 IPR020428 GO:0016791(InterPro)
Cec03g1081 200 PRINTS Plant and fungal dual specificity phosphatase signature 14 31 IPR020428 GO:0016791(InterPro)
Cec03g1081 200 PRINTS Plant and fungal dual specificity phosphatase signature 70 84 IPR020428 GO:0016791(InterPro)
Cec03g1081 200 PRINTS Plant and fungal dual specificity phosphatase signature 51 64 IPR020428 GO:0016791(InterPro)
Cec03g1081 200 PANTHER TYROSINE-PROTEIN PHOSPHATASE 13 191 - GO:0005737(PANTHER)|GO:0016791(PANTHER)
Cec03g1081 200 ProSiteProfiles Dual specificity protein phosphatase domain profile. 19 170 IPR020422 GO:0006470(InterPro)
Cec03g1081 200 CDD PFA-DSP_Siw14 13 160 - -
Cec03g1081 200 ProSitePatterns Tyrosine specific protein phosphatases active site. 109 119 IPR016130 GO:0016311(InterPro)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec03g1081 K18045 - - csv:101211082 367.466
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec03g1081 Cec-Chr3:22447885 Cec09g1099 Cec-Chr9:10827108 3.80E-56 dispersed
Cec03g1081 Cec-Chr3:22447885 Cec02g1896 Cec-Chr2:36733456 7.10E-63 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g847 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Cla03g01026 Cam03g1077 Cec03g1081 Cco03g1073 Clacu03g1046 Cmu03g1637 Cre03g1338 Lsi06g00702 . . Cme02g00915
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cec04g1397 . 57 630 Protein tyrosine phosphatase (PTP) family AT3G50110 62.3 4.4e-191 664.8
Cec02g0662 . 42 612 Protein tyrosine phosphatase (PTP) family AT3G50110 58.1 7.7e-180 627.5
Cec10g1555 . 289 658 Protein tyrosine phosphatase (PTP) family AT5G39400 69.2 1.4e-153 539.7
Cec08g0834 . 1 684 Protein tyrosine phosphatase (PTP) family AT3G10550 74.3 1.3e-299 1025.8
Cec08g0834 . 1 684 Protein tyrosine phosphatase (PTP) family AT5G04540 71.1 2.8e-286 981.5
Cec06g1416 . 1 1257 Protein tyrosine phosphatase (PTP) family AT5G58160 55.5 0.0e+00 1085.9
Cec05g1807 . 1 1362 Protein tyrosine phosphatase (PTP) family AT5G58160 50.8 1.4e-305 1046.2
Cec09g1024 . 87 351 Protein tyrosine phosphatase (PTP) family AT1G71860 65.4 3.5e-102 368.6
Cec06g2025 . 201 1098 Protein tyrosine phosphatase (PTP) family AT5G23720 65.5 0.0e+00 1098.2
Cec06g0587 . 75 214 Protein tyrosine phosphatase (PTP) family AT3G06110 57.1 2.0e-42 169.1
Cec09g2184 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 77.5 2.2e-71 265.4
Cec05g2366 . 96 376 Protein tyrosine phosphatase (PTP) family AT3G52180 69.4 1.1e-114 409.8
Cec07g0550 . 10 271 Protein tyrosine phosphatase (PTP) family AT3G10940 65.3 6.2e-97 350.9
Cec10g1431 . 143 591 Protein tyrosine phosphatase (PTP) family AT3G01510 72.2 2.5e-201 698.4
Cec02g1896 . 91 292 Protein tyrosine phosphatase (PTP) family AT2G32960 59.5 1.8e-74 276.2
Cec09g1099 . 25 233 Protein tyrosine phosphatase (PTP) family AT2G32960 63.9 2.0e-73 272.7
Cec03g1081 . 3 170 Protein tyrosine phosphatase (PTP) family AT2G32960 51.5 1.6e-54 209.9
Cec10g0247 . 83 415 Protein tyrosine phosphatase (PTP) family AT2G35680 55.2 7.2e-100 360.9
Cec11g0207 . 17 263 Protein tyrosine phosphatase (PTP) family AT2G35680 55.3 1.3e-80 297.0
Cec11g0207 . 27 218 Protein tyrosine phosphatase (PTP) family AT5G56610 50.5 1.3e-45 179.9
Cec10g0247 . 119 294 Protein tyrosine phosphatase (PTP) family AT5G56610 50.6 5.9e-43 171.0
Cec02g1896 . 125 293 Protein tyrosine phosphatase (PTP) family AT4G03960 78.1 2.3e-77 285.4
Cec09g1099 . 34 233 Protein tyrosine phosphatase (PTP) family AT4G03960 64.0 6.0e-70 260.8
Cec03g1081 . 13 170 Protein tyrosine phosphatase (PTP) family AT4G03960 62.7 1.4e-58 223.0
Cec03g1081 . 7 196 Protein tyrosine phosphatase (PTP) family AT3G02800 71.6 3.8e-80 294.7
Cec02g1896 . 116 288 Protein tyrosine phosphatase (PTP) family AT3G02800 60.7 4.5e-57 218.0
Cec07g0343 . 1 188 Protein tyrosine phosphatase (PTP) family AT3G55270 65.6 7.3e-63 239.2
Cec10g1555 . 289 658 Protein tyrosine phosphatase (PTP) family AT5G39400 69.2 1.4e-153 539.7
Cec02g0662 . 33 612 Protein tyrosine phosphatase (PTP) family AT3G19420 66.7 1.9e-220 762.3
Cec04g1397 . 55 630 Protein tyrosine phosphatase (PTP) family AT3G19420 60.8 1.0e-197 686.8
Cec04g1397 . 57 630 Protein tyrosine phosphatase (PTP) family AT3G50110 62.3 4.4e-191 664.8
Cec02g0662 . 42 612 Protein tyrosine phosphatase (PTP) family AT3G50110 58.1 7.7e-180 627.5
Cec06g1416 . 1 1257 Protein tyrosine phosphatase (PTP) family AT5G58160 55.5 0.0e+00 1085.9
Cec05g1807 . 1 1362 Protein tyrosine phosphatase (PTP) family AT5G58160 50.8 1.4e-305 1046.2
Cec08g0834 . 1 684 Protein tyrosine phosphatase (PTP) family AT3G10550 74.3 1.3e-299 1025.8
Cec08g0834 . 1 684 Protein tyrosine phosphatase (PTP) family AT5G04540 71.1 2.8e-286 981.5
Cec02g2310 . 67 249 Protein tyrosine phosphatase (PTP) family AT3G44620 64.6 6.7e-69 257.7
Cec10g0184 . 22 308 Protein tyrosine phosphatase (PTP) family AT2G35320 63.4 3.2e-107 385.2
Cec04g0863 . 1 721 Protein tyrosine phosphatase (PTP) family AT3G09100 65.7 8.2e-281 963.0
Cec04g0863 . 5 721 Protein tyrosine phosphatase (PTP) family AT5G01290 61.3 1.2e-252 869.4
Cec04g0863 . 86 721 Protein tyrosine phosphatase (PTP) family AT5G28210 52.4 5.8e-180 627.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0008556 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 35