Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cec04g0715 ATGAACGACTTGATGACCAAATCGTTCACCAGCTATGTGGATCTGAAGAAGGCAGCCATGAAAGATCTCGACCTCGAAGCTGGGTTAGAAATGCCATCGTCCGCTACTGGAGACAACGGTGACATGGGTCTTTTTCTCGAAGAAGCTGAGAAGGTGAAGATGGAGATGGGTTCAATTCGAGAGATTTTAGTTAAACTCCAACAAGCTAATGAGGAGACCAAATCTGCTCACAAACCCGAAACTCTCAAATCGCTTCGTAATACGATCAATGTCAACATCATCACCGTCCTGAAAAAGGCGCGATCGATCCGATCTCAGCTTGAGGAAATGGACCGCGCCAATGCTGCAAAGAAACGTCTTTCTGGCAGCAAAGAAGGCACTGCCATTTACCGGACGAGAATTGCGGTGACAAACGGGCTGCGGAAGAAGCTAAAGGAATTGATGATGGAGTTTCAGAGCTTGAGGCAGAGGATGATGACGGAGTACAAGGAAACGGTCGGGCGAAGGTATTTCACGGTGACGGGGGAGCATCCGGAGGAGGAGGTGATAGAGAAGATAATATCCAATGGAGGAGAGGAGTTTTTGGGGAGGGCGATAGAGGAGCACGGGCGGGGGAAAGTGGCGGAGACGGTGGTGGAGATACAAGACCGACACGGGGCGGCGAAGGAGATAGAGAAGAGTTTGCTAGAGCTACACCAAGTGTTTTTGGATATGGCAGTGATGGTTGAAGCACAAGGGGAAAAAATGGATGATATTGAACATCATGTGATGAATGCTTCACAATATGTTAGGGATGGGACTAAGGATTTGAAGACTGCAAAAGATTTGCAAAGGAACAGTAGGAAATGTATGTGTTTTGGGATTTTTCTTTTGCTTCTGATTATTTTGGTTGTTGTTATTCCTATTGCTGTTAGTTTTGGAAGTTCTTGA 930 46.56 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEMPSSATGDNGDMGLFLEEAEKVKMEMGSIREILVKLQQANEETKSAHKPETLKSLRNTINVNIITVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEHPEEEVIEKIISNGGEEFLGRAIEEHGRGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVRDGTKDLKTAKDLQRNSRKCMCFGIFLLLLIILVVVIPIAVSFGSS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 26294206 26295210 - CePI673135_04g007150.1 Cec04g0715 200197

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cec04g0715 309 CDD SNARE_syntaxin1-like 210 272 - -
Cec04g0715 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cec04g0715 309 Gene3D - 37 166 - -
Cec04g0715 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Cec04g0715 309 FunFam Syntaxin 132 204 304 - -
Cec04g0715 309 PANTHER SYNTAXIN 48 294 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cec04g0715 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cec04g0715 309 SMART tSNARE_6 206 273 IPR000727 -
Cec04g0715 309 CDD SynN 42 198 IPR006011 GO:0016020(InterPro)
Cec04g0715 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020(InterPro)
Cec04g0715 309 Pfam SNARE domain 248 299 IPR000727 -
Cec04g0715 309 Coils Coil 137 157 - -
Cec04g0715 309 SMART SynN_4 37 163 IPR006011 GO:0016020(InterPro)
Cec04g0715 309 Gene3D - 206 307 - -
Cec04g0715 309 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 39 169 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec04g0715 K08486 - - csv:101220775 563.148
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec04g0715 Cec-Chr4:26294206 Cec10g1837 Cec-Chr10:33175462 3.70E-58 dispersed
Cec04g0715 Cec-Chr4:26294206 Cec04g1193 Cec-Chr4:31507906 1.90E-59 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec04g0715 . 1 309 SNARE and Associated Proteins AT1G08560 69.3 6.0e-101 364.4
Cec04g1660 . 23 325 SNARE and Associated Proteins AT2G18260 54.2 7.7e-85 310.8
Cec10g1837 . 19 279 SNARE and Associated Proteins AT3G11820 80.5 1.3e-114 409.8
Cec04g1193 . 22 282 SNARE and Associated Proteins AT3G11820 71.6 5.0e-103 371.3
Cec03g0540 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Cec10g1365 . 442 696 SNARE and Associated Proteins AT3G11820 52.5 8.0e-69 257.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 4.7e-91 331.6
Cec04g1193 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 1.7e-85 313.2
Cec03g0540 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cec10g1365 . 444 696 SNARE and Associated Proteins AT3G52400 51.0 6.0e-62 235.0
Cec03g0540 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 4.2e-83 305.1
Cec04g1193 . 1 297 SNARE and Associated Proteins AT4G03330 52.3 6.3e-79 291.2
Cec10g1365 . 433 696 SNARE and Associated Proteins AT4G03330 53.8 3.9e-68 255.4
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G61290 62.4 6.1e-90 327.8
Cec04g1193 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.2e-85 313.5
Cec10g1365 . 448 696 SNARE and Associated Proteins AT1G61290 50.6 8.3e-63 237.7
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G11250 62.0 4.9e-92 334.7
Cec04g1193 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 6.2e-87 317.8
Cec10g1365 . 432 696 SNARE and Associated Proteins AT1G11250 50.6 2.1e-66 249.6
Cec10g1365 . 417 715 SNARE and Associated Proteins AT3G03800 74.2 6.7e-113 404.1
Cec02g0887 . 38 271 SNARE and Associated Proteins AT3G03800 59.8 6.4e-71 264.6
Cec10g1365 . 417 614 SNARE and Associated Proteins AT5G08080 78.4 1.0e-78 290.0
Cec02g0887 . 24 224 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 6.6e-75 277.7
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 3.0e-80 295.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 5.8e-73 271.2
Cec10g0147 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 3.3e-52 202.6
Cec07g0462 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 1.8e-111 399.4
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec02g1601 . 34 359 SNARE and Associated Proteins AT5G26980 76.7 7.8e-128 453.8
Cec09g0536 . 1 317 SNARE and Associated Proteins AT5G26980 66.2 6.9e-100 360.9
Cec02g1601 . 34 359 SNARE and Associated Proteins AT4G02195 64.0 3.5e-104 375.2
Cec09g0536 . 1 317 SNARE and Associated Proteins AT4G02195 66.1 1.9e-102 369.4
Cec02g1601 . 34 359 SNARE and Associated Proteins AT3G05710 76.1 1.1e-129 459.9
Cec09g0536 . 1 317 SNARE and Associated Proteins AT3G05710 63.7 3.6e-96 348.6
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G16240 72.7 5.7e-80 294.3
Cec10g0467 . 32 247 SNARE and Associated Proteins AT1G16240 68.5 1.2e-77 286.6
Cec10g0467 . 27 247 SNARE and Associated Proteins AT1G79590 67.0 5.5e-79 291.2
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G79590 71.3 5.1e-77 284.6
Cec06g0054 . 136 326 SNARE and Associated Proteins AT1G28490 71.7 8.1e-67 250.4
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G09740 79.3 1.0e-112 403.3
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.9e-95 345.9
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G45280 64.0 3.2e-87 318.5
Cec10g2046 . 104 364 SNARE and Associated Proteins AT3G61450 68.2 5.4e-95 344.4
Cec02g2216 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.0e-85 312.0
Cec11g0667 . 65 307 SNARE and Associated Proteins AT1G51740 73.1 1.4e-89 326.2
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32