Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cec04g1660 ATGTCGTCGTCGGTCGACGTTATATCTCCCGCCTGCACGTCTAATAACAAACTCAGATCGGCGAAGATGAACGATTTAATGACGAAATCATTCTTAAGTTATGTGGTATTAAAGAAACAGGCACAGAGGGATGCCGTAGGCGGCGGCGGCGACGGCTTCGACATTGAATCCGGCGGCCAAGAACTCAATCCGACGGAAGAACAGAACCTGTCTCTGTTTTTCGAACAAGTCGATGAAATCAAGACCCAAATGGAAGAGACAACCAATCTCTTAGTTGACATTCAAAAACTAAATCAAGAAGCGAAATCAACTCACAACGCCAAAATCCTCCGCGGAATAAGAGACAGAATCGACTCCGACATGGTATCAATCCTCCGCAGAGCAAGAATCCTCAAAGAAAAATTGGCCTCTCTCGACCAATCCAACACCGCAAACCGCCTGATCTCCGTCGCGTACGGCGAAGGAACCGCTGTGGACCGGACAAGAACTTCAGTCACGAACGGACTGAGAGTGAAATTGAGAGAAATGATGAACGAATTTCAGAGATTGAGAGAAAAAGTTGTGGAGGATCACAAGGAGGATCTGAGAAGAAGATATTTTGGTGCAAATGGGGAACAACCCAGTGACGAACAAGTGGAGAAGATTATGTATGGGAGTTTGAAATTGGAAACGTTTGAAGGGAAATTGAGCGAGACCGAGTTAGGGGACCGAGTCAGGCACGAATCAGTGATGGATATACAGAGGAGTTTGAATAAGCTTCATCAGGTGTTTTTGGATATGGCGATTTTGGTTGAGAGTGAAGGGGAGAAGATGGAGGACATTGAGGAGAATGTAGCGAAAGCTGGGAAGTTCATCAATGGCGGAACTCGAAGCCTTCATTATGCGAACCAGATGAAGAGGAAGAACAAGAAATGGGTGTATTGGGTTTGGGCTATCATTTTTGTTATATTGCTTGTTTGCATTGTTTCAATGTTGGTTTGTTGA 984 45.12 MSSSVDVISPACTSNNKLRSAKMNDLMTKSFLSYVVLKKQAQRDAVGGGGDGFDIESGGQELNPTEEQNLSLFFEQVDEIKTQMEETTNLLVDIQKLNQEAKSTHNAKILRGIRDRIDSDMVSILRRARILKEKLASLDQSNTANRLISVAYGEGTAVDRTRTSVTNGLRVKLREMMNEFQRLREKVVEDHKEDLRRRYFGANGEQPSDEQVEKIMYGSLKLETFEGKLSETELGDRVRHESVMDIQRSLNKLHQVFLDMAILVESEGEKMEDIEENVAKAGKFINGGTRSLHYANQMKRKNKKWVYWVWAIIFVILLVCIVSMLVC 327
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 35814281 35815553 - CePI673135_04g016600.1 Cec04g1660 201142

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cec04g1660 327 Coils Coil 166 193 - -
Cec04g1660 327 SMART tSNARE_6 228 295 IPR000727 -
Cec04g1660 327 CDD SynN 73 215 IPR006011 GO:0016020(InterPro)
Cec04g1660 327 Pfam Syntaxin 73 268 IPR006011 GO:0016020(InterPro)
Cec04g1660 327 Gene3D - 65 196 - -
Cec04g1660 327 Gene3D - 228 326 - -
Cec04g1660 327 Coils Coil 77 97 - -
Cec04g1660 327 SMART SynN_4 65 192 IPR006011 GO:0016020(InterPro)
Cec04g1660 327 FunFam Syntaxin 132 226 326 - -
Cec04g1660 327 CDD SNARE_syntaxin1-like 239 292 - -
Cec04g1660 327 PANTHER SYNTAXIN 73 316 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cec04g1660 327 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 239 295 IPR000727 -
Cec04g1660 327 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 67 198 - -
Cec04g1660 327 SUPERFAMILY t-snare proteins 69 288 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec04g1660 K08486 - - csv:101217836 539.65
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec04g1193 Cec-Chr4:31507906 Cec04g1660 Cec-Chr4:35814281 3.80E-44 dispersed
Cec04g1660 Cec-Chr4:35814281 Cec10g1365 Cec-Chr10:27908105 2.30E-34 dispersed
Cec04g1660 Cec-Chr4:35814281 Cec10g1837 Cec-Chr10:33175462 1.80E-47 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec04g0715 . 1 309 SNARE and Associated Proteins AT1G08560 69.3 6.0e-101 364.4
Cec04g1660 . 23 325 SNARE and Associated Proteins AT2G18260 54.2 7.7e-85 310.8
Cec10g1837 . 19 279 SNARE and Associated Proteins AT3G11820 80.5 1.3e-114 409.8
Cec04g1193 . 22 282 SNARE and Associated Proteins AT3G11820 71.6 5.0e-103 371.3
Cec03g0540 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Cec10g1365 . 442 696 SNARE and Associated Proteins AT3G11820 52.5 8.0e-69 257.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 4.7e-91 331.6
Cec04g1193 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 1.7e-85 313.2
Cec03g0540 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Cec10g1365 . 444 696 SNARE and Associated Proteins AT3G52400 51.0 6.0e-62 235.0
Cec03g0540 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Cec10g1837 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 4.2e-83 305.1
Cec04g1193 . 1 297 SNARE and Associated Proteins AT4G03330 52.3 6.3e-79 291.2
Cec10g1365 . 433 696 SNARE and Associated Proteins AT4G03330 53.8 3.9e-68 255.4
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G61290 62.4 6.1e-90 327.8
Cec04g1193 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.2e-85 313.5
Cec10g1365 . 448 696 SNARE and Associated Proteins AT1G61290 50.6 8.3e-63 237.7
Cec03g0540 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cec10g1837 . 1 279 SNARE and Associated Proteins AT1G11250 62.0 4.9e-92 334.7
Cec04g1193 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 6.2e-87 317.8
Cec10g1365 . 432 696 SNARE and Associated Proteins AT1G11250 50.6 2.1e-66 249.6
Cec10g1365 . 417 715 SNARE and Associated Proteins AT3G03800 74.2 6.7e-113 404.1
Cec02g0887 . 38 271 SNARE and Associated Proteins AT3G03800 59.8 6.4e-71 264.6
Cec10g1365 . 417 614 SNARE and Associated Proteins AT5G08080 78.4 1.0e-78 290.0
Cec02g0887 . 24 224 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 6.6e-75 277.7
Cec10g0147 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 3.0e-80 295.4
Cec10g0147 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 5.8e-73 271.2
Cec10g0147 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 3.3e-52 202.6
Cec07g0462 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 1.8e-111 399.4
Cec08g1324 . 37 351 SNARE and Associated Proteins AT3G24350 61.0 1.7e-94 343.2
Cec02g1601 . 34 359 SNARE and Associated Proteins AT5G26980 76.7 7.8e-128 453.8
Cec09g0536 . 1 317 SNARE and Associated Proteins AT5G26980 66.2 6.9e-100 360.9
Cec02g1601 . 34 359 SNARE and Associated Proteins AT4G02195 64.0 3.5e-104 375.2
Cec09g0536 . 1 317 SNARE and Associated Proteins AT4G02195 66.1 1.9e-102 369.4
Cec02g1601 . 34 359 SNARE and Associated Proteins AT3G05710 76.1 1.1e-129 459.9
Cec09g0536 . 1 317 SNARE and Associated Proteins AT3G05710 63.7 3.6e-96 348.6
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G16240 72.7 5.7e-80 294.3
Cec10g0467 . 32 247 SNARE and Associated Proteins AT1G16240 68.5 1.2e-77 286.6
Cec10g0467 . 27 247 SNARE and Associated Proteins AT1G79590 67.0 5.5e-79 291.2
Cec09g1092 . 1 209 SNARE and Associated Proteins AT1G79590 71.3 5.1e-77 284.6
Cec06g0054 . 136 326 SNARE and Associated Proteins AT1G28490 71.7 8.1e-67 250.4
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G09740 79.3 1.0e-112 403.3
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.9e-95 345.9
Cec02g2216 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Cec10g2046 . 104 367 SNARE and Associated Proteins AT3G45280 64.0 3.2e-87 318.5
Cec10g2046 . 104 364 SNARE and Associated Proteins AT3G61450 68.2 5.4e-95 344.4
Cec02g2216 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.0e-85 312.0
Cec11g0667 . 65 307 SNARE and Associated Proteins AT1G51740 73.1 1.4e-89 326.2
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002433 5 3 5 4 2 1 2 1 2 2 1 1 2 1 2 1 1 3 2 1 2 3 2 2 1 1 1 2 1 4 61