Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cec05g2772 ATGATAATTCCGGTGCGGTGCTTCACTTGCGGCAAGGTGATCGGTAACAAATGGGACACTTATCTCGAGCTTCTTCAAGCAGACTATCCGGAAGGAGAGGCATTGGATATGTTAGGGTTAGTACGGTACTGTTGTCGGAGGATGCTTATGACTCATGTGGATCTCATTGAGAAGCTCTTGAACTACAATACCATGGATAAGTCTGAAATCATCTAG 216 44.91 MIIPVRCFTCGKVIGNKWDTYLELLQADYPEGEALDMLGLVRYCCRRMLMTHVDLIEKLLNYNTMDKSEII 71
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
5 38141990 38142440 + CePI673135_05g027720.1 Cec05g2772 204575

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cec05g2772 71 PIRSF RpoN_RPB10 1 71 IPR000268 GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0006351(InterPro)
Cec05g2772 71 Pfam RNA polymerases N / 8 kDa subunit 2 59 IPR000268 GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0006351(InterPro)
Cec05g2772 71 Gene3D - 1 69 - -
Cec05g2772 71 PANTHER DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC5 FAMILY MEMBER 1 69 IPR000268 GO:0001054(PANTHER)|GO:0001055(PANTHER)|GO:0001056(PANTHER)|GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0003899(PANTHER)|GO:0005665(PANTHER)|GO:0005666(PANTHER)|GO:0005736(PANTHER)|GO:0006351(InterPro)|GO:0006360(PANTHER)|GO:0006366(PANTHER)|GO:0008270(PANTHER)|GO:0042797(PANTHER)
Cec05g2772 71 SUPERFAMILY RNA polymerase subunit RPB10 1 63 IPR023580 -
Cec05g2772 71 Hamap DNA-directed RNA polymerase subunit Rpo10 [rpo10]. 2 56 IPR000268 GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0006351(InterPro)
Cec05g2772 71 ProSitePatterns RNA polymerases N / 8 Kd subunits signature. 2 11 IPR020789 GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0006351(InterPro)|GO:0008270(InterPro)
Cec05g2772 71 FunFam DNA-directed RNA polymerases I, II, and III subunit 1 69 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec05g2772 K03007 - - csv:101211391 150.599
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec05g2772 Cec-Chr5:38141990 Cec08g0827 Cec-Chr8:20100352 2.10E-33 dispersed
Cec05g2772 Cec-Chr5:38141990 Cec08g1851 Cec-Chr8:29350228 9.70E-31 wgd
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi1g671 . . . . . Bpe10g00844 Bma14g01802 Bma15g00179 . . . . . . Sed07g2568 . . Bhi07g01744 Tan04g0166 Cmetu10g0943 Lac13g0190 Hepe10g0024 . . Cla05g02552 Cam05g2740 Cec05g2772 Cco05g2812 Clacu05g2741 . . . . . . Lsi04g00560 Csa05g02326 Chy10g00893 Cme10g00536 Blo06g00883 . Bda07g01611 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001943 3 3 1 3 3 2 1 3 3 3 3 2 1 2 2 2 1 1 2 1 2 1 3 0 2 3 2 2 3 1 61