Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cec08g1357 ATGAGTAGGCCGGGGGATTGGAATTGCAGGTCTTGCAACCATCTCAACTTTCAACGAAGGGATTCGTGTCACCGATGTGGAGAGCCTAGGGCCGATTTCGGCGTCGGAAGCTACGGCGGCGGAAGAGTTGTTGGTTCTTCGTCCTTTGGTTTCACCACCGGCCCCGACGTCCGCCCTGGGGATTGGTACTGCACCGTCGCCAACTGCGGCGCTCATAACTTCGCTAGCCGCTCTATCTGCTTCAAGTGCGGCGCCTCCAAGGATGAGGCTTCCGCCGCAGCCTACGACGGCGATTTGACCAGAATGAGAGGCTTTAACTTCGGCGGTGCCTCCAACCGCCCTGGATGGAAATCTGGTGATTGGATCTGTGCCAGTAATTTTAGTTATTATTATTTTGTCGTCACATATTTACGTCATCGGATTGCAATGAGCATAACTTTGCCAGCCGAAGGGAATGCTTTAGATGCAATGCGCCAAGGGATTCCAACAGCAGGTCGCCATACTCGTAAAGGTGGTGCCAATGGAAGGAATAAATTCTAG 540 52.96 MSRPGDWNCRSCNHLNFQRRDSCHRCGEPRADFGVGSYGGGRVVGSSSFGFTTGPDVRPGDWYCTVANCGAHNFASRSICFKCGASKDEASAAAYDGDLTRMRGFNFGGASNRPGWKSGDWICASNFSYYYFVVTYLRHRIAMSITLPAEGNALDAMRQGIPTAGRHTRKGGANGRNKF 179
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
8 25507397 25509063 + CePI673135_08g013570.1 Cec08g1357 209999

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cec08g1357 179 Pfam Zn-finger in Ran binding protein and others 58 87 IPR001876 -
Cec08g1357 179 Pfam Zn-finger in Ran binding protein and others 3 29 IPR001876 -
Cec08g1357 179 ProSitePatterns Zinc finger RanBP2-type signature. 62 83 IPR001876 -
Cec08g1357 179 Gene3D - 54 90 - -
Cec08g1357 179 Gene3D - 2 32 - -
Cec08g1357 179 SUPERFAMILY Ran binding protein zinc finger-like 2 31 IPR036443 -
Cec08g1357 179 SUPERFAMILY Ran binding protein zinc finger-like 54 89 IPR036443 -
Cec08g1357 179 SMART zf_4 60 86 IPR001876 -
Cec08g1357 179 SMART zf_4 5 29 IPR001876 -
Cec08g1357 179 ProSiteProfiles Zinc finger RanBP2 type profile. 3 32 IPR001876 -
Cec08g1357 179 FunFam Ran-binding zinc finger protein 52 89 - -
Cec08g1357 179 ProSitePatterns Zinc finger RanBP2-type signature. 7 26 IPR001876 -
Cec08g1357 179 ProSiteProfiles Zinc finger RanBP2 type profile. 58 89 IPR001876 -
Cec08g1357 179 PANTHER ZINC FINGER PROTEIN 56 131 - GO:0003729(PANTHER)|GO:0005737(PANTHER)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cec08g1357 - - - - 0.0
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cec06g1254 Cec-Chr6:25630312 Cec08g1357 Cec-Chr8:25507397 2.80E-23 dispersed
Cec11g0295 Cec-Chr11:3183973 Cec08g1357 Cec-Chr8:25507397 7.40E-20 wgd
Cec07g1400 Cec-Chr7:29568356 Cec08g1357 Cec-Chr8:25507397 1.40E-36 wgd
Cec08g1357 Cec-Chr8:25507397 Cec09g0266 Cec-Chr9:2321869 1.60E-37 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g452 Blo01g01377 . Bda01g00734 . . Bpe02g00572 . . Cmo05g00409 Cmo12g00277 . Cma05g00396 . Car12g00309 Sed01g1363 Cpe07g00286 . Bhi04g00986 Tan02g2707 Cmetu03g1356 . . . Lcy13g1766 . . . . . . . Cone4ag1804 Cone7ag1712 . . . . . Cme03g01640 . . . . . . . . . . . . Cma12g00327 . Car05g00333 Cpe11g00340 . . . . . . . . Cla08g01315 Cam08g1775 Cec08g1357 Cco08g1477 Clacu08g1471 . Cre08g1258 Lsi08g01180 . Chy03g01140 .
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001025 2 6 2 1 2 1 5 2 2 2 1 1 4 3 3 5 2 4 4 1 2 3 3 2 3 2 3 5 5 2 83