Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Chy01g01724 ATGTCTTCCGATTCTCATGCCCCTACTCCAAGGGGTCTTCTCTGTAATGCTGGAGCTGGTGCTGCTGCTGGTGTTCTTGCTGCTACGTTTGTGTGCCCTTTGGATGTCATCAAGACTAGATTTCAGGTTCATGGATTGCCAAACATCGGTAAAGGGAGTCTTATAGTTGGGAGTCTGCAACAAATTTTTCATAAGGAGGGGCTACGTGGAATGTATAGAGGTCTTGCACCTACTGTGCTTGCATTACTGCCTAACTGGGCTGTTTATTTCACAATATATGGGCAGCTTAAAACCTTTCTTGCCTCTGATCATGAACATTGTCAGCTTTCAATAGGTGCTAATATGATGGCTGCTTCTGGTGCTGGGGCTGCTACAACTATTGCAACCAATCCTCTATGGGTAGTCAAGACCAGGCTTCAGACACAAGGAATGAAATCTGGTGTGCTACCATATAGAAATACAGTGTCTGCCTTAAAGAGAATAGCATCTGAAGAAGGAATTCGTGGATTGTACAGTGGTCTTGTGCCTGCTTTGGCCGGTGTAAGTCACGTTGCGATTCAGTTTCCAACATATGAAAAAATTAAAAGTTATTTGGCTAGAAGAGACAATACAACAACGGACAAACTCACTGCACGTGATGTTGCAGTTGCCTCATCTGTTTCTAAGATATTTGCTTCCACGTTGACCTATCCACATGAGGTCGTACGATCCAGGCTTCAGGAACAGGGGTTTCACTCTGAAAAGCGTTATTCTGGCGTAGCCGATTGCGTAAAGAAAGTATTTCAGCAAGATGGTCTTCCCGGTTTCTATCGAGGGTGTGCAACCAACCTTCTCAGGACAACGCCTGCTGCTGTCATCACATTTACCAGCTTTGAAATGATTCACCGATTTCTTGCCAACTTATTTCCTCCCGATCCACATCCACACACATTATGA 936 44.66 MSSDSHAPTPRGLLCNAGAGAAAGVLAATFVCPLDVIKTRFQVHGLPNIGKGSLIVGSLQQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTIYGQLKTFLASDHEHCQLSIGANMMAASGAGAATTIATNPLWVVKTRLQTQGMKSGVLPYRNTVSALKRIASEEGIRGLYSGLVPALAGVSHVAIQFPTYEKIKSYLARRDNTTTDKLTARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGFHSEKRYSGVADCVKKVFQQDGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLANLFPPDPHPHTL* 312
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
1 23024676 23028127 - Chy1G017240.1 Chy01g01724 218905

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Chy01g01724 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 209 297 IPR018108 -
Chy01g01724 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 99 IPR018108 -
Chy01g01724 311 Gene3D Mitochondrial carrier domain 1 105 IPR023395 -
Chy01g01724 311 Gene3D Mitochondrial carrier domain 106 301 IPR023395 -
Chy01g01724 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 109 197 IPR018108 -
Chy01g01724 311 PANTHER NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1, CHLOROPLASTIC 1 310 - -
Chy01g01724 311 SUPERFAMILY Mitochondrial carrier 13 293 IPR023395 -
Chy01g01724 311 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 1 310 IPR044712 GO:0006862|GO:0055085
Chy01g01724 311 Pfam Mitochondrial carrier protein 109 200 IPR018108 -
Chy01g01724 311 Pfam Mitochondrial carrier protein 15 102 IPR018108 -
Chy01g01724 311 Pfam Mitochondrial carrier protein 215 299 IPR018108 -
Chy01g01724 311 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085
Chy01g01724 311 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085
Chy01g01724 311 PRINTS Mitochondrial carrier protein signature 74 94 IPR002067 GO:0055085
Chy01g01724 311 PRINTS Mitochondrial carrier protein signature 124 142 IPR002067 GO:0055085
Chy01g01724 311 PRINTS Mitochondrial carrier protein signature 218 240 IPR002067 GO:0055085
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Chy01g01724 K15115 SLC25A32, MFT; solute carrier family 25 (mitochondrial folate transporter), member 32 - csv:101204681 601.668
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Chy01g01724 Chy-Chr1:23024676 Chy09g00893 Chy-Chr9:11700638 1.26E-131 dispersed
Chy01g01724 Chy-Chr1:23024676 Chy03g01130 Chy-Chr3:14566422 3.16E-09 transposed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi7g348 . . . . . . Bma13g00073 . Cmo08g00433 Cmo17g01033 . . . . Sed07g0813 Cpe17g00770 . Bhi09g00933 Tan06g0765 Cmetu09g1187 . Hepe03g1870 . . Cla09g00508 Cam09g0550 Cec09g0540 Cco09g0536 Clacu09g0550 . Cre09g0528 Cone17ag0445 Cone20ag0967 . . Lsi02g02438 Csa07g01874 . Cme01g02233 . . . . . . . . . . . Cma08g00444 . . Car17g01010 . Cpe12g00913 . . . . . . . . . . . . . . . . Chy01g01724 .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Chy12g00180 . 1 399 Chloroplast and Mitochondria Gene Families AT2G28800 64.5 1.3e-135 479.9
Chy03g01693 . 71 425 Chloroplast and Mitochondria Gene Families AT2G28800 54.7 1.7e-98 356.7
Chy03g00521 . 3 256 Chloroplast and Mitochondria Gene Families AT1G15820 79.7 8.1e-117 416.8
Chy01g00514 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 89.9 1.1e-144 509.6
Chy02g00166 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.4 9.0e-120 426.8
Chy11g01011 . 2 263 Chloroplast and Mitochondria Gene Families AT3G27690 78.8 2.6e-119 425.2
Chy04g01189 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.6 6.5e-118 420.6
Chy06g01728 . 5 265 Chloroplast and Mitochondria Gene Families AT3G27690 66.8 4.3e-98 354.8
Chy02g00167 . 2 218 Chloroplast and Mitochondria Gene Families AT3G27690 73.5 1.2e-92 336.7
Chy09g00113 . 70 273 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.4e-51 200.3
Chy10g00781 . 16 254 Chloroplast and Mitochondria Gene Families AT3G61470 86.7 1.7e-127 452.2
Chy02g01290 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 65.0 2.5e-86 315.5
Chy02g02491 CCT,ECH 270 497 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 6.0e-64 241.1
Chy09g00695 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 9.1e-90 326.6
Chy08g00647 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 83.7 5.1e-136 480.7
Chy07g00435 . 55 245 Chloroplast and Mitochondria Gene Families AT1G76570 77.5 3.4e-88 322.0
Chy07g00436 . 46 149 Chloroplast and Mitochondria Gene Families AT1G76570 78.8 5.0e-47 185.3
Chy02g01569 . 1 293 Chloroplast and Mitochondria Gene Families AT1G61520 76.5 3.4e-121 431.4
Chy01g00514 . 1 266 Chloroplast and Mitochondria Gene Families AT2G05070 90.2 7.2e-145 510.0
Chy02g00166 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 77.9 2.3e-119 425.2
Chy11g01011 . 7 263 Chloroplast and Mitochondria Gene Families AT2G05070 79.4 2.6e-118 421.8
Chy04g01189 . 27 266 Chloroplast and Mitochondria Gene Families AT2G05070 83.8 2.2e-117 418.7
Chy06g01728 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 68.2 1.7e-98 355.9
Chy02g00167 . 5 218 Chloroplast and Mitochondria Gene Families AT2G05070 74.4 7.1e-92 334.0
Chy01g00514 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.9 1.2e-125 446.4
Chy11g01011 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 78.2 4.0e-102 368.2
Chy02g00166 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.1 2.2e-100 362.5
Chy04g01189 . 27 237 Chloroplast and Mitochondria Gene Families AT2G05100 82.5 3.2e-99 358.6
Chy02g00167 . 5 218 Chloroplast and Mitochondria Gene Families AT2G05100 74.4 2.5e-91 332.4
Chy06g01728 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 1.9e-83 306.2
Chy08g00647 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 7.2e-67 250.4
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29930 88.6 1.2e-134 476.1
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.7 5.8e-134 473.8
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29930 84.6 5.8e-126 447.2
Chy01g00514 . 3 266 Chloroplast and Mitochondria Gene Families AT1G29930 78.7 2.4e-116 415.2
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT1G29930 85.9 9.6e-105 376.7
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29930 70.4 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29930 51.1 1.7e-53 206.5
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29920 88.3 4.4e-134 474.2
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 2.2e-133 471.9
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29920 84.6 7.5e-126 446.8
Chy01g00514 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29920 83.8 3.2e-116 414.8
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT1G29920 85.5 3.6e-104 374.8
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29920 70.4 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29920 51.1 1.7e-53 206.5
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29910 88.3 4.4e-134 474.2
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 2.2e-133 471.9
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29910 84.6 7.5e-126 446.8
Chy01g00514 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29910 83.8 3.2e-116 414.8
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT1G29910 85.5 3.6e-104 374.8
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29910 70.4 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29910 51.1 1.7e-53 206.5
Chy09g00113 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 84.0 3.8e-136 481.1
Chy02g00166 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.0e-57 218.0
Chy04g01189 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 7.8e-57 217.6
Chy11g01011 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.0e-56 217.2
Chy01g00514 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.8e-54 209.1
Chy06g01728 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 1.2e-52 203.8
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34420 88.6 7.5e-134 473.4
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 2.4e-132 468.4
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT2G34420 85.0 1.2e-126 449.5
Chy01g00514 . 3 266 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 1.4e-116 416.0
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT2G34420 84.5 6.8e-103 370.5
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT2G34420 70.8 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT2G34420 50.2 8.4e-53 204.1
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 1.8e-135 478.8
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34430 87.5 1.8e-132 468.8
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT2G34430 85.3 1.6e-128 455.7
Chy01g00514 . 30 266 Chloroplast and Mitochondria Gene Families AT2G34430 82.9 2.3e-114 408.7
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT2G34430 85.8 5.1e-106 380.9
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT2G34430 71.5 6.9e-95 344.0
Chy08g00647 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 84.9 1.7e-139 492.3
Chy06g01591 . 48 308 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 7.8e-144 506.5
Chy06g01591 . 1 308 Chloroplast and Mitochondria Gene Families AT3G27240 86.4 3.9e-150 527.7
Chy11g01383 . 5 324 Chloroplast and Mitochondria Gene Families AT2G30160 75.1 5.4e-142 500.7
Chy08g00612 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 65.5 1.8e-113 406.0
Chy11g01383 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.5 5.9e-141 497.3
Chy08g00612 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 68.5 9.9e-120 426.8
Chy01g01724 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.1 6.1e-135 477.2
Chy09g00893 . 11 312 Chloroplast and Mitochondria Gene Families AT2G47490 64.9 7.2e-112 400.6
Chy09g00893 . 10 303 Chloroplast and Mitochondria Gene Families AT1G25380 72.5 1.7e-120 429.5
Chy01g01724 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.2 4.0e-106 381.7
Chy12g00977 . 627 1206 Chloroplast and Mitochondria Gene Families AT4G21490 74.5 6.2e-258 886.7
Chy11g01079 . 1 586 Chloroplast and Mitochondria Gene Families AT4G21490 68.8 5.8e-240 827.0
Chy01g00375 . 1 575 Chloroplast and Mitochondria Gene Families AT4G21490 64.1 2.6e-224 775.0
Chy01g02191 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.4 4.8e-63 237.7
Chy02g01804 . 1 172 Chloroplast and Mitochondria Gene Families AT1G17530 56.9 3.3e-48 188.3
Chy02g01804 . 1 172 Chloroplast and Mitochondria Gene Families AT3G04800 55.5 1.4e-46 183.0
Chy01g02191 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 55.1 1.1e-41 166.8
Chy01g02191 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.4 2.1e-61 232.3
Chy02g01804 . 3 172 Chloroplast and Mitochondria Gene Families AT1G72750 56.6 6.4e-47 184.1
Chy10g01108 . 700 874 Chloroplast and Mitochondria Gene Families AT1G26100 66.3 1.3e-65 246.5
Chy09g00143 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 6.8e-91 330.5
Chy04g00019 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.0 4.1e-82 301.6
Chy02g02696 . 26 334 Chloroplast and Mitochondria Gene Families AT5G14040 84.9 1.1e-154 543.1
Chy06g01467 . 11 350 Chloroplast and Mitochondria Gene Families AT5G14040 74.0 1.5e-151 532.7
Chy01g00582 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 5.3e-85 311.6
Chy06g01467 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 69.7 8.3e-144 506.9
Chy02g02696 . 27 334 Chloroplast and Mitochondria Gene Families AT3G48850 75.3 1.6e-139 492.7
Chy01g00582 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.9 2.0e-84 309.7
Chy01g00582 . 14 311 Chloroplast and Mitochondria Gene Families AT2G17270 76.2 6.2e-132 467.2
Chy06g01467 . 57 355 Chloroplast and Mitochondria Gene Families AT2G17270 51.8 1.8e-86 316.2
Chy09g00188 . 16 313 Chloroplast and Mitochondria Gene Families AT5G15640 77.7 4.6e-130 461.1
Chy07g00267 . 60 393 Chloroplast and Mitochondria Gene Families AT5G26200 68.3 1.3e-125 446.4
Chy01g02185 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 4.2e-105 378.3
Chy01g02185 . 1 351 Chloroplast and Mitochondria Gene Families AT1G72820 74.9 4.5e-147 517.7
Chy07g00267 . 49 394 Chloroplast and Mitochondria Gene Families AT1G72820 67.9 1.9e-129 459.1
Chy08g00665 . 1 107 Chloroplast and Mitochondria Gene Families AT1G72820 76.6 1.3e-40 164.1
Chy09g01257 . 33 230 Chloroplast and Mitochondria Gene Families AT5G52570 51.3 2.8e-44 175.6
Chy06g00974 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 61.4 5.1e-67 251.1
Chy09g01257 . 33 148 Chloroplast and Mitochondria Gene Families AT4G25700 77.6 9.0e-48 187.2
Chy01g00388 . 113 291 Chloroplast and Mitochondria Gene Families AT4G03320 51.7 3.3e-55 212.2
Chy06g01726 . 75 363 Chloroplast and Mitochondria Gene Families AT5G54290 80.1 2.6e-121 432.2
Chy02g02178 . 55 549 Chloroplast and Mitochondria Gene Families AT2G18710 85.7 3.2e-240 827.8
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002161 2 2 0 1 2 2 3 2 2 2 2 2 2 2 2 3 2 4 2 2 2 2 2 2 2 2 2 4 2 2 63
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Chy01g01724 Chy_Chr01 FPKM 0.866084 0.0 1.064015 1.026537 0.365834 0.638959 0.186662 1.965638 1.126513 1.462677