Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Chy04g02075 ATGAGCGTGATCGACCTTTTGACCAGAGTAGATGCGATCTGCCAGAAGTACGACAAATATGACATAGAAAAGCAGAGAGATCTCAATGTCTCCGGCGACGATGCCTTCGCTCGTCTCTACGCCACTGTTGAAGCTGACATTGAAGCTGCTCTACAGAAAGCGGAGGATGCTTCTAAAGAGAAGAATAGGGCATCCGTTGTGGCATTGAATGCAGAGATTCGTCGTACAAAAGCTCGTTTACTGGAGGAAGTTCCCAAGTTGCAAAGGTTGGCTGTTAAGAGGGTTAAAGGGCTATCAACTGAAGATCTTACCACTCGAAATGATTTGGTGCTTGCATTACCGGATAGAATTCAAGCTATACCAGATGGAACTGTGACTACCACGAAGAATAATGGGGGCTGGACATCCTCAGCTTCACGGACTGAAATCAAATTTGACTCAGATGGGCGGTTTGATGATGAGTACTTCCAACACACCGAGCAGTCCAGTCAGTTCAGGCAGGAGTATGAAATGAGGAAAATGAAGCAGGATCAAGGATTGGACATGATATCAGAAGGGTTGGATACTCTGAAGAATATGGCACATGATATGAATGAGGAAATAGACAGGCAAGTCCCTTTGATGGACGAGATTGACACTAAGGTGGACAAGGCTGCATCTGACCTTAAGAACACCAACGTTAGATTAAAGGACACAGTTAACCAGCCGATGATCGATGAATGTCGTTGCCATGTAAGGTCATCCTTCCCTAATGGATTGTATACAACCATTGCTTTTGTTTATGATATCAATTTGGACATGCATCTCAAAGTTGATCATAATCAAAACTTTGATCAGACGGGTAGTCCTTTTGGCTTCTCTCTACTGCCCATTATAGCCCGGGAGAAAATGGAGATGAGGAATGAGGATTGA 912 44.19 MSVIDLLTRVDAICQKYDKYDIEKQRDLNVSGDDAFARLYATVEADIEAALQKAEDASKEKNRASVVALNAEIRRTKARLLEEVPKLQRLAVKRVKGLSTEDLTTRNDLVLALPDRIQAIPDGTVTTTKNNGGWTSSASRTEIKFDSDGRFDDEYFQHTEQSSQFRQEYEMRKMKQDQGLDMISEGLDTLKNMAHDMNEEIDRQVPLMDEIDTKVDKAASDLKNTNVRLKDTVNQPMIDECRCHVRSSFPNGLYTTIAFVYDINLDMHLKVDHNQNFDQTGSPFGFSLLPIIAREKMEMRNED* 304
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 26217224 26220965 - Chy4G087930.1 Chy04g02075 225974

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Chy04g02075 303 CDD SNARE_Qc 175 230 - -
Chy04g02075 303 Gene3D - 170 231 - -
Chy04g02075 303 SMART tSNARE_6 165 232 IPR000727 -
Chy04g02075 303 PANTHER SYNTAXIN 1 233 IPR045242 -
Chy04g02075 303 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 170 232 IPR000727 -
Chy04g02075 303 Coils Coil 40 60 - -
Chy04g02075 303 ProSitePatterns Syntaxin / epimorphin family signature. 176 215 IPR006012 GO:0005484|GO:0006886|GO:0016020
Chy04g02075 303 PANTHER SYNTAXIN-73 1 233 - -
Chy04g02075 303 SUPERFAMILY SNARE fusion complex 165 230 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Chy04g02075 K08506 SYP7; syntaxin of plants SYP7 - csv:101215905 459.144
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Chy04g00793 Chy-Chr4:10202039 Chy04g02075 Chy-Chr4:26217224 6.95E-172 dispersed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g590 . . . . Bpe04g01584 . . . . Cmo14g00195 . . . . . . . . . . . . . . . . . . . . . . . Cone13ag1275 Cone19ag1262 . . . Cme04g02538 . . . . . . . . Sed04g1347 . . . Cma14g00203 . Car14g00181 Cpe03g00174 . Bhi11g02112 Tan08g1893 Cmetu04g1845 Lac10g3026 Hepe05g0250 . . Cla10g01938 Cam10g2004 Cec10g2046 Cco10g2031 Clacu10g2011 Cmu10g2760 Cre10g2153 Lsi03g02035 Csa03g03265 Chy04g02075 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Chy03g01173 . 476 779 SNARE and Associated Proteins AT3G24350 62.5 3.1e-90 328.9
Chy08g00517 . 1 310 SNARE and Associated Proteins AT1G08560 66.4 1.4e-99 359.8
Chy02g00640 . 1 303 SNARE and Associated Proteins AT2G18260 53.8 3.7e-84 308.5
Chy04g01850 . 22 279 SNARE and Associated Proteins AT3G11820 80.6 3.0e-113 405.2
Chy08g00980 . 25 284 SNARE and Associated Proteins AT3G11820 70.0 3.5e-98 355.1
Chy12g00974 . 31 281 SNARE and Associated Proteins AT3G11820 65.3 2.4e-91 332.4
Chy04g01397 . 21 280 SNARE and Associated Proteins AT3G11820 51.5 7.2e-67 251.1
Chy04g01850 . 31 279 SNARE and Associated Proteins AT3G52400 69.5 3.8e-90 328.6
Chy08g00980 . 36 284 SNARE and Associated Proteins AT3G52400 66.7 1.7e-85 313.2
Chy12g00974 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 2.1e-80 296.2
Chy12g00974 . 1 299 SNARE and Associated Proteins AT4G03330 67.9 4.0e-107 384.8
Chy04g01850 . 1 278 SNARE and Associated Proteins AT4G03330 56.9 1.9e-80 296.2
Chy08g00980 . 1 302 SNARE and Associated Proteins AT4G03330 54.0 1.8e-78 289.7
Chy04g01397 . 34 280 SNARE and Associated Proteins AT4G03330 54.7 9.1e-67 250.8
Chy12g00974 . 1 299 SNARE and Associated Proteins AT1G61290 79.6 1.2e-127 453.0
Chy04g01850 . 1 279 SNARE and Associated Proteins AT1G61290 62.6 2.2e-89 325.9
Chy08g00980 . 1 296 SNARE and Associated Proteins AT1G61290 55.7 1.3e-81 300.1
Chy04g01397 . 35 280 SNARE and Associated Proteins AT1G61290 50.4 6.7e-62 234.6
Chy12g00974 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.2e-124 443.0
Chy04g01850 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 2.3e-91 332.4
Chy08g00980 . 1 296 SNARE and Associated Proteins AT1G11250 55.4 3.0e-83 305.4
Chy04g01397 . 35 280 SNARE and Associated Proteins AT1G11250 51.6 5.4e-64 241.5
Chy04g01397 . 3 299 SNARE and Associated Proteins AT3G03800 73.1 3.0e-110 395.2
Chy11g00597 . 42 297 SNARE and Associated Proteins AT3G03800 58.2 3.3e-77 285.4
Chy04g01397 . 3 198 SNARE and Associated Proteins AT5G08080 76.5 6.6e-75 277.3
Chy11g00597 . 24 214 SNARE and Associated Proteins AT5G08080 59.2 3.9e-51 198.4
Chy06g02160 . 1 256 SNARE and Associated Proteins AT5G16830 58.8 1.4e-74 276.6
Chy06g02160 . 1 256 SNARE and Associated Proteins AT5G46860 65.2 6.9e-79 290.8
Chy06g02160 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 3.3e-73 271.9
Chy06g02160 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 9.2e-52 201.1
Chy10g00436 . 1 336 SNARE and Associated Proteins AT5G05760 65.6 3.9e-111 398.3
Chy03g01173 . 476 779 SNARE and Associated Proteins AT3G24350 62.5 3.1e-90 328.9
Chy05g01060 . 1 317 SNARE and Associated Proteins AT5G26980 75.7 1.5e-123 439.5
Chy01g01727 . 1 310 SNARE and Associated Proteins AT5G26980 66.6 1.6e-101 366.3
Chy01g01727 . 1 309 SNARE and Associated Proteins AT4G02195 67.4 9.8e-104 373.6
Chy05g01060 . 1 317 SNARE and Associated Proteins AT4G02195 62.4 1.5e-99 359.8
Chy05g01060 . 1 317 SNARE and Associated Proteins AT3G05710 74.5 1.2e-125 446.4
Chy01g01727 . 1 310 SNARE and Associated Proteins AT3G05710 63.7 4.1e-97 351.7
Chy01g01059 . 1 234 SNARE and Associated Proteins AT1G16240 73.1 1.5e-90 329.3
Chy06g01863 . 4 231 SNARE and Associated Proteins AT1G16240 65.8 5.6e-77 284.3
Chy01g01059 . 1 234 SNARE and Associated Proteins AT1G79590 72.6 1.1e-89 326.6
Chy06g01863 . 4 231 SNARE and Associated Proteins AT1G79590 65.4 3.8e-77 285.0
Chy11g01970 . 106 260 SNARE and Associated Proteins AT1G28490 69.7 2.9e-53 205.3
Chy04g00793 . 1 261 SNARE and Associated Proteins AT3G09740 77.9 7.5e-110 393.7
Chy04g02075 . 1 235 SNARE and Associated Proteins AT3G09740 76.8 2.1e-96 349.0
Chy04g00793 . 1 261 SNARE and Associated Proteins AT3G45280 65.5 4.0e-87 318.2
Chy04g02075 . 1 230 SNARE and Associated Proteins AT3G45280 64.4 5.1e-74 274.6
Chy04g00793 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 7.9e-96 347.1
Chy04g02075 . 1 235 SNARE and Associated Proteins AT3G61450 66.4 3.8e-82 301.6
Chy03g00164 . 65 309 SNARE and Associated Proteins AT1G51740 73.3 1.7e-92 335.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Chy04g02075 Chy_Chr04 FPKM 8.631918 10.521763 9.627852 10.783285 15.27849 10.960213 14.624581 20.322735 16.477913 16.076662