Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Chy08g00517 ATGAACGACTTAATGACCAAATCGTTCACAAGCTATGTGGATCTGAAGAAGGCAGCCATGAAGGATCTCGACCTTGAAGCCGGTCTAGAAAAGGCATCATCTGTTACCGGCGACAACGGTGACATGGGTCTGTTTCTGGAAGAGGCAGAGAAGGTGAAAATGGAGATGGGTTCGATTAGAGAGATTTTAGTTAAACTCCAACAAGCTAATGAAGAGACCAAATCTGCTCACAAACCTGAAACCCTCAAATTGCTTCGTAATGCGATCAATGTCGACATTGTCACTGTCCTCAAAAAGGCAAGATCTATCCGATCTCAGCTTGAGGAAATGGATCGTGCCAACGCTGCCAAGAAACGTCTCTCCGGAAGCAAAGAAGGCACTGCCATTTACAGGACAAGAATTGCAGTGACCAACGGGCTACGGAAGAAGCTAAAGGAATTAATGATGGAGTTTCAAAGCTTGAGGCAGAGGATGATGACGGAGTACAAAGAAACGGTTGGGCGCCGATACTTCACGGTGACGGGGGAGAATCCGGAGGAGGAGGTAATAGAGAAGATAATATCGAATGGAGGGGAGGAGTTTTTAGCAAGGGCAATAGAGGAGCATGGGCGAGGGAAGGTGGCGGAGACGGTGGTGGAGATACAGGACCGACACGGGGCCGCGAAGGAGATAGAGAAGAGCTTGTTAGAGCTACACCAAGTGTTTTTGGATATGGCAGTCATGGTTGAAGCACAAGGGGAGAAAATGGATGATATTGAACATCACGTTATGAATGCTTCGCAATATGTTATAGATGGGACCAAGGATTTGAAAACAGCAAAGGATTTGCAAAGGAATAGTAGAAAATGTTTGTGTTTTGGGATTTTCCTTTTGCTTGTGATTATTTTGGTTGTTGTTATTCCAATTGCTGTTAGTTTTGGAAGTTCTTGA 930 45.16 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEKASSVTGDNGDMGLFLEEAEKVKMEMGSIREILVKLQQANEETKSAHKPETLKLLRNAINVDIVTVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGENPEEEVIEKIISNGGEEFLARAIEEHGRGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVIDGTKDLKTAKDLQRNSRKCLCFGIFLLLVIILVVVIPIAVSFGSS* 310
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
8 12391637 12392764 - Chy8G151220.1 Chy08g00517 232303

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Chy08g00517 309 PANTHER SYNTAXIN 4 302 IPR045242 -
Chy08g00517 309 CDD SNARE_syntaxin1-like 210 272 - -
Chy08g00517 309 SMART tSNARE_6 206 273 IPR000727 -
Chy08g00517 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Chy08g00517 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020
Chy08g00517 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484|GO:0006886|GO:0016020
Chy08g00517 309 CDD SynN 42 198 IPR006011 GO:0016020
Chy08g00517 309 Pfam SNARE domain 248 299 IPR000727 -
Chy08g00517 309 PANTHER SYNTAXIN-RELATED PROTEIN KNOLLE 4 302 - -
Chy08g00517 309 Gene3D - 37 166 - -
Chy08g00517 309 SMART SynN_4 37 163 IPR006011 GO:0016020
Chy08g00517 309 Coils Coil 137 157 - -
Chy08g00517 309 Gene3D - 206 307 - -
Chy08g00517 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020|GO:0016192
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Chy08g00517 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101220775 557.37
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Chy02g00640 Chy-Chr2:3907457 Chy08g00517 Chy-Chr8:12391637 2.93E-73 dispersed
Chy08g00517 Chy-Chr8:12391637 Chy12g00974 Chy-Chr12:15035977 3.10E-92 dispersed
Chy08g00517 Chy-Chr8:12391637 Chy04g01850 Chy-Chr4:24681494 4.23E-79 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Chy03g01173 . 476 779 SNARE and Associated Proteins AT3G24350 62.5 3.1e-90 328.9
Chy08g00517 . 1 310 SNARE and Associated Proteins AT1G08560 66.4 1.4e-99 359.8
Chy02g00640 . 1 303 SNARE and Associated Proteins AT2G18260 53.8 3.7e-84 308.5
Chy04g01850 . 22 279 SNARE and Associated Proteins AT3G11820 80.6 3.0e-113 405.2
Chy08g00980 . 25 284 SNARE and Associated Proteins AT3G11820 70.0 3.5e-98 355.1
Chy12g00974 . 31 281 SNARE and Associated Proteins AT3G11820 65.3 2.4e-91 332.4
Chy04g01397 . 21 280 SNARE and Associated Proteins AT3G11820 51.5 7.2e-67 251.1
Chy04g01850 . 31 279 SNARE and Associated Proteins AT3G52400 69.5 3.8e-90 328.6
Chy08g00980 . 36 284 SNARE and Associated Proteins AT3G52400 66.7 1.7e-85 313.2
Chy12g00974 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 2.1e-80 296.2
Chy12g00974 . 1 299 SNARE and Associated Proteins AT4G03330 67.9 4.0e-107 384.8
Chy04g01850 . 1 278 SNARE and Associated Proteins AT4G03330 56.9 1.9e-80 296.2
Chy08g00980 . 1 302 SNARE and Associated Proteins AT4G03330 54.0 1.8e-78 289.7
Chy04g01397 . 34 280 SNARE and Associated Proteins AT4G03330 54.7 9.1e-67 250.8
Chy12g00974 . 1 299 SNARE and Associated Proteins AT1G61290 79.6 1.2e-127 453.0
Chy04g01850 . 1 279 SNARE and Associated Proteins AT1G61290 62.6 2.2e-89 325.9
Chy08g00980 . 1 296 SNARE and Associated Proteins AT1G61290 55.7 1.3e-81 300.1
Chy04g01397 . 35 280 SNARE and Associated Proteins AT1G61290 50.4 6.7e-62 234.6
Chy12g00974 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.2e-124 443.0
Chy04g01850 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 2.3e-91 332.4
Chy08g00980 . 1 296 SNARE and Associated Proteins AT1G11250 55.4 3.0e-83 305.4
Chy04g01397 . 35 280 SNARE and Associated Proteins AT1G11250 51.6 5.4e-64 241.5
Chy04g01397 . 3 299 SNARE and Associated Proteins AT3G03800 73.1 3.0e-110 395.2
Chy11g00597 . 42 297 SNARE and Associated Proteins AT3G03800 58.2 3.3e-77 285.4
Chy04g01397 . 3 198 SNARE and Associated Proteins AT5G08080 76.5 6.6e-75 277.3
Chy11g00597 . 24 214 SNARE and Associated Proteins AT5G08080 59.2 3.9e-51 198.4
Chy06g02160 . 1 256 SNARE and Associated Proteins AT5G16830 58.8 1.4e-74 276.6
Chy06g02160 . 1 256 SNARE and Associated Proteins AT5G46860 65.2 6.9e-79 290.8
Chy06g02160 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 3.3e-73 271.9
Chy06g02160 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 9.2e-52 201.1
Chy10g00436 . 1 336 SNARE and Associated Proteins AT5G05760 65.6 3.9e-111 398.3
Chy03g01173 . 476 779 SNARE and Associated Proteins AT3G24350 62.5 3.1e-90 328.9
Chy05g01060 . 1 317 SNARE and Associated Proteins AT5G26980 75.7 1.5e-123 439.5
Chy01g01727 . 1 310 SNARE and Associated Proteins AT5G26980 66.6 1.6e-101 366.3
Chy01g01727 . 1 309 SNARE and Associated Proteins AT4G02195 67.4 9.8e-104 373.6
Chy05g01060 . 1 317 SNARE and Associated Proteins AT4G02195 62.4 1.5e-99 359.8
Chy05g01060 . 1 317 SNARE and Associated Proteins AT3G05710 74.5 1.2e-125 446.4
Chy01g01727 . 1 310 SNARE and Associated Proteins AT3G05710 63.7 4.1e-97 351.7
Chy01g01059 . 1 234 SNARE and Associated Proteins AT1G16240 73.1 1.5e-90 329.3
Chy06g01863 . 4 231 SNARE and Associated Proteins AT1G16240 65.8 5.6e-77 284.3
Chy01g01059 . 1 234 SNARE and Associated Proteins AT1G79590 72.6 1.1e-89 326.6
Chy06g01863 . 4 231 SNARE and Associated Proteins AT1G79590 65.4 3.8e-77 285.0
Chy11g01970 . 106 260 SNARE and Associated Proteins AT1G28490 69.7 2.9e-53 205.3
Chy04g00793 . 1 261 SNARE and Associated Proteins AT3G09740 77.9 7.5e-110 393.7
Chy04g02075 . 1 235 SNARE and Associated Proteins AT3G09740 76.8 2.1e-96 349.0
Chy04g00793 . 1 261 SNARE and Associated Proteins AT3G45280 65.5 4.0e-87 318.2
Chy04g02075 . 1 230 SNARE and Associated Proteins AT3G45280 64.4 5.1e-74 274.6
Chy04g00793 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 7.9e-96 347.1
Chy04g02075 . 1 235 SNARE and Associated Proteins AT3G61450 66.4 3.8e-82 301.6
Chy03g00164 . 65 309 SNARE and Associated Proteins AT1G51740 73.3 1.7e-92 335.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Chy08g00517 Chy_Chr08 FPKM 1.408932 1.290591 2.55782 2.879022 4.38769 3.647818 4.113603 3.725887 3.538299 4.130411