Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Chy11g01011 ATGGCAGCTTCATCCATGGCTCTCTCCTCCCCATCCTTCGCCGGCCAAGCCGTCAAATTATCCCCCACCTCCTCCGACCTCCTCGGCGAAGGCCGCATTACCATGAGAAAAACCGCCGGAAAGCCCAAGCCCGTTTCCTCCGGTAGCCCATGGTACGGTCCCGATCGTGTCAAATACCTAGGCCCATTCTCTGGAGAACCCCCATCCTATCTAACCGGAGAATTCCCCGGTGACTACGGTTGGGACACTGCCGGCCTCTCCGCCGACCCCGAAACCTTCGCCAAAAACCGTGAACTCGAAGTAATCCACTCGAGATGGGCCATGCTCGGAGCCTTAGGCTGCGTATTCCCGGAGCTCCTCTCCCGAAACGGAGTCAAATTCGGCGAGGCTGTGTGGTTCAAAGCTGGATCACAAATCTTCAGCGAAGGTGGGCTCGACTATTTGGGGAACCCAAGCTTGGTGCACGCACAGAGCATTCTAGCGATTTGGGCATGTCAAGTAGTGCTCATGGGCGCAGTGGAAGGGTACAGAATTGCTGGGGGTCCGTTGGGTGAAATCACTGACCCGATTTACCCAGGTGGGAGCTTTGATCCATTGGGGCTGGCTGATGATCCAGAGGCATTCGCGGAATTGAAAGTGAAGGAGCTTAAGAATGGTAGATTGGCTATGTTTTCGATGTTCGGATTTTTCGTACAAGCGATTGTAACTGGGAAAGGGCCATTGGAGAATTTGGCTGATCACTTGGCTGACCCTGTTAACAACAATGCTTGGGCCTATGCTACTAACTTTGATGGACACAAAATTATTGGTGCCAAAAGAACTAGTGAGGCTAGCTCTTCAAAAGGTCAAGATGATAAGAAAACTAAATTTGAATCTAGAAGAAACAAAAGAGCTAGGAAAGCTACTTCTTTTGGATTAGATTTCATAATATACATGATAGAAGTGATAGTGTTGGTTGAGTCGGCATGTCGATTACTCATCATGCAGTCTGATTGA 996 50.1 MAASSMALSSPSFAGQAVKLSPTSSDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFDGHKIIGAKRTSEASSSKGQDDKKTKFESRRNKRARKATSFGLDFIIYMIEVIVLVESACRLLIMQSD* 332
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
11 14276644 14289144 - Chy11G195910.1 Chy11g01011 236772

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Chy11g01011 331 Gene3D Chlorophyll a/b binding protein domain 58 260 - -
Chy11g01011 331 MobiDBLite consensus disorder prediction 274 294 - -
Chy11g01011 331 Pfam Chlorophyll A-B binding protein 67 233 IPR022796 -
Chy11g01011 331 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 3, CHLOROPLASTIC 1 264 - -
Chy11g01011 331 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 1 264 IPR001344 GO:0009765|GO:0016020
Chy11g01011 331 SUPERFAMILY Chlorophyll a-b binding protein 50 263 - -
Chy11g01011 331 MobiDBLite consensus disorder prediction 278 294 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Chy11g01011 K08912 LHCB1; light-harvesting complex II chlorophyll a/b binding protein 1 - csv:101213845 536.569
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Chy01g00514 Chy-Chr1:3707462 Chy11g01011 Chy-Chr11:14276644 2.71E-150 dispersed
Chy02g00167 Chy-Chr2:1173807 Chy11g01011 Chy-Chr11:14276644 2.38E-148 dispersed
Chy04g01189 Chy-Chr4:18266412 Chy11g01011 Chy-Chr11:14276644 2.42E-168 dispersed
Chy06g01728 Chy-Chr6:20138010 Chy11g01011 Chy-Chr11:14276644 2.36E-118 dispersed
Chy11g01011 Chy-Chr11:14276644 Chy10g00781 Chy-Chr10:13858504 5.42E-37 dispersed
Chy07g00436 Chy-Chr7:3342271 Chy11g01011 Chy-Chr11:14276644 3.88E-22 transposed
Chy09g00113 Chy-Chr9:941941 Chy11g01011 Chy-Chr11:14276644 8.39E-67 transposed
Chy07g00435 Chy-Chr7:3334144 Chy11g01011 Chy-Chr11:14276644 3.49E-31 transposed
Chy11g01011 Chy-Chr11:14276644 Chy02g00166 Chy-Chr2:1171702 0 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi12g46 . . . . . . . . . . Cma02g00036 Cma20g00260 . . . . . . . . . . . . Cla02g01804 Cam02g1907 Cec02g1928 Cco02g1970 Clacu02g1889 Cmu02g1834 Cre02g2152 . . . . Lsi10g01537 . Chy11g01011 . . . . . . . . . . Cmo02g00036 Cmo20g00287 . . . . Cpe16g00726 . Bhi10g00982 . . . . . . . . . . . . . . Csa06g01182 . Cme11g01575
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Chy12g00180 . 1 399 Chloroplast and Mitochondria Gene Families AT2G28800 64.5 1.3e-135 479.9
Chy03g01693 . 71 425 Chloroplast and Mitochondria Gene Families AT2G28800 54.7 1.7e-98 356.7
Chy03g00521 . 3 256 Chloroplast and Mitochondria Gene Families AT1G15820 79.7 8.1e-117 416.8
Chy01g00514 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 89.9 1.1e-144 509.6
Chy02g00166 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.4 9.0e-120 426.8
Chy11g01011 . 2 263 Chloroplast and Mitochondria Gene Families AT3G27690 78.8 2.6e-119 425.2
Chy04g01189 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.6 6.5e-118 420.6
Chy06g01728 . 5 265 Chloroplast and Mitochondria Gene Families AT3G27690 66.8 4.3e-98 354.8
Chy02g00167 . 2 218 Chloroplast and Mitochondria Gene Families AT3G27690 73.5 1.2e-92 336.7
Chy09g00113 . 70 273 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.4e-51 200.3
Chy10g00781 . 16 254 Chloroplast and Mitochondria Gene Families AT3G61470 86.7 1.7e-127 452.2
Chy02g01290 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 65.0 2.5e-86 315.5
Chy02g02491 CCT,ECH 270 497 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 6.0e-64 241.1
Chy09g00695 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 9.1e-90 326.6
Chy08g00647 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 83.7 5.1e-136 480.7
Chy07g00435 . 55 245 Chloroplast and Mitochondria Gene Families AT1G76570 77.5 3.4e-88 322.0
Chy07g00436 . 46 149 Chloroplast and Mitochondria Gene Families AT1G76570 78.8 5.0e-47 185.3
Chy02g01569 . 1 293 Chloroplast and Mitochondria Gene Families AT1G61520 76.5 3.4e-121 431.4
Chy01g00514 . 1 266 Chloroplast and Mitochondria Gene Families AT2G05070 90.2 7.2e-145 510.0
Chy02g00166 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 77.9 2.3e-119 425.2
Chy11g01011 . 7 263 Chloroplast and Mitochondria Gene Families AT2G05070 79.4 2.6e-118 421.8
Chy04g01189 . 27 266 Chloroplast and Mitochondria Gene Families AT2G05070 83.8 2.2e-117 418.7
Chy06g01728 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 68.2 1.7e-98 355.9
Chy02g00167 . 5 218 Chloroplast and Mitochondria Gene Families AT2G05070 74.4 7.1e-92 334.0
Chy01g00514 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.9 1.2e-125 446.4
Chy11g01011 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 78.2 4.0e-102 368.2
Chy02g00166 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.1 2.2e-100 362.5
Chy04g01189 . 27 237 Chloroplast and Mitochondria Gene Families AT2G05100 82.5 3.2e-99 358.6
Chy02g00167 . 5 218 Chloroplast and Mitochondria Gene Families AT2G05100 74.4 2.5e-91 332.4
Chy06g01728 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 1.9e-83 306.2
Chy08g00647 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 7.2e-67 250.4
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29930 88.6 1.2e-134 476.1
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.7 5.8e-134 473.8
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29930 84.6 5.8e-126 447.2
Chy01g00514 . 3 266 Chloroplast and Mitochondria Gene Families AT1G29930 78.7 2.4e-116 415.2
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT1G29930 85.9 9.6e-105 376.7
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29930 70.4 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29930 51.1 1.7e-53 206.5
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29920 88.3 4.4e-134 474.2
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 2.2e-133 471.9
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29920 84.6 7.5e-126 446.8
Chy01g00514 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29920 83.8 3.2e-116 414.8
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT1G29920 85.5 3.6e-104 374.8
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29920 70.4 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29920 51.1 1.7e-53 206.5
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29910 88.3 4.4e-134 474.2
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 2.2e-133 471.9
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29910 84.6 7.5e-126 446.8
Chy01g00514 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29910 83.8 3.2e-116 414.8
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT1G29910 85.5 3.6e-104 374.8
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29910 70.4 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29910 51.1 1.7e-53 206.5
Chy09g00113 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 84.0 3.8e-136 481.1
Chy02g00166 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.0e-57 218.0
Chy04g01189 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 7.8e-57 217.6
Chy11g01011 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.0e-56 217.2
Chy01g00514 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.8e-54 209.1
Chy06g01728 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 1.2e-52 203.8
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34420 88.6 7.5e-134 473.4
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 2.4e-132 468.4
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT2G34420 85.0 1.2e-126 449.5
Chy01g00514 . 3 266 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 1.4e-116 416.0
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT2G34420 84.5 6.8e-103 370.5
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT2G34420 70.8 1.5e-94 342.8
Chy09g00113 . 53 273 Chloroplast and Mitochondria Gene Families AT2G34420 50.2 8.4e-53 204.1
Chy02g00166 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 1.8e-135 478.8
Chy11g01011 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34430 87.5 1.8e-132 468.8
Chy04g01189 . 4 266 Chloroplast and Mitochondria Gene Families AT2G34430 85.3 1.6e-128 455.7
Chy01g00514 . 30 266 Chloroplast and Mitochondria Gene Families AT2G34430 82.9 2.3e-114 408.7
Chy02g00167 . 1 218 Chloroplast and Mitochondria Gene Families AT2G34430 85.8 5.1e-106 380.9
Chy06g01728 . 34 265 Chloroplast and Mitochondria Gene Families AT2G34430 71.5 6.9e-95 344.0
Chy08g00647 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 84.9 1.7e-139 492.3
Chy06g01591 . 48 308 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 7.8e-144 506.5
Chy06g01591 . 1 308 Chloroplast and Mitochondria Gene Families AT3G27240 86.4 3.9e-150 527.7
Chy11g01383 . 5 324 Chloroplast and Mitochondria Gene Families AT2G30160 75.1 5.4e-142 500.7
Chy08g00612 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 65.5 1.8e-113 406.0
Chy11g01383 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.5 5.9e-141 497.3
Chy08g00612 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 68.5 9.9e-120 426.8
Chy01g01724 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.1 6.1e-135 477.2
Chy09g00893 . 11 312 Chloroplast and Mitochondria Gene Families AT2G47490 64.9 7.2e-112 400.6
Chy09g00893 . 10 303 Chloroplast and Mitochondria Gene Families AT1G25380 72.5 1.7e-120 429.5
Chy01g01724 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.2 4.0e-106 381.7
Chy12g00977 . 627 1206 Chloroplast and Mitochondria Gene Families AT4G21490 74.5 6.2e-258 886.7
Chy11g01079 . 1 586 Chloroplast and Mitochondria Gene Families AT4G21490 68.8 5.8e-240 827.0
Chy01g00375 . 1 575 Chloroplast and Mitochondria Gene Families AT4G21490 64.1 2.6e-224 775.0
Chy01g02191 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.4 4.8e-63 237.7
Chy02g01804 . 1 172 Chloroplast and Mitochondria Gene Families AT1G17530 56.9 3.3e-48 188.3
Chy02g01804 . 1 172 Chloroplast and Mitochondria Gene Families AT3G04800 55.5 1.4e-46 183.0
Chy01g02191 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 55.1 1.1e-41 166.8
Chy01g02191 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.4 2.1e-61 232.3
Chy02g01804 . 3 172 Chloroplast and Mitochondria Gene Families AT1G72750 56.6 6.4e-47 184.1
Chy10g01108 . 700 874 Chloroplast and Mitochondria Gene Families AT1G26100 66.3 1.3e-65 246.5
Chy09g00143 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 6.8e-91 330.5
Chy04g00019 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.0 4.1e-82 301.6
Chy02g02696 . 26 334 Chloroplast and Mitochondria Gene Families AT5G14040 84.9 1.1e-154 543.1
Chy06g01467 . 11 350 Chloroplast and Mitochondria Gene Families AT5G14040 74.0 1.5e-151 532.7
Chy01g00582 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 5.3e-85 311.6
Chy06g01467 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 69.7 8.3e-144 506.9
Chy02g02696 . 27 334 Chloroplast and Mitochondria Gene Families AT3G48850 75.3 1.6e-139 492.7
Chy01g00582 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.9 2.0e-84 309.7
Chy01g00582 . 14 311 Chloroplast and Mitochondria Gene Families AT2G17270 76.2 6.2e-132 467.2
Chy06g01467 . 57 355 Chloroplast and Mitochondria Gene Families AT2G17270 51.8 1.8e-86 316.2
Chy09g00188 . 16 313 Chloroplast and Mitochondria Gene Families AT5G15640 77.7 4.6e-130 461.1
Chy07g00267 . 60 393 Chloroplast and Mitochondria Gene Families AT5G26200 68.3 1.3e-125 446.4
Chy01g02185 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 4.2e-105 378.3
Chy01g02185 . 1 351 Chloroplast and Mitochondria Gene Families AT1G72820 74.9 4.5e-147 517.7
Chy07g00267 . 49 394 Chloroplast and Mitochondria Gene Families AT1G72820 67.9 1.9e-129 459.1
Chy08g00665 . 1 107 Chloroplast and Mitochondria Gene Families AT1G72820 76.6 1.3e-40 164.1
Chy09g01257 . 33 230 Chloroplast and Mitochondria Gene Families AT5G52570 51.3 2.8e-44 175.6
Chy06g00974 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 61.4 5.1e-67 251.1
Chy09g01257 . 33 148 Chloroplast and Mitochondria Gene Families AT4G25700 77.6 9.0e-48 187.2
Chy01g00388 . 113 291 Chloroplast and Mitochondria Gene Families AT4G03320 51.7 3.3e-55 212.2
Chy06g01726 . 75 363 Chloroplast and Mitochondria Gene Families AT5G54290 80.1 2.6e-121 432.2
Chy02g02178 . 55 549 Chloroplast and Mitochondria Gene Families AT2G18710 85.7 3.2e-240 827.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201